KEGG   Methanosarcina sp. WWM596: MSWHS_1301Help
Entry
MSWHS_1301        CDS       T03852                                 

Definition
(GenBank) Superoxide dismutase [Cu-Zn] precursor
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
meq  Methanosarcina sp. WWM596
Brite
Enzymes [BR:meq01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     MSWHS_1301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1578442..1578978
Genome map
AA seq 178 aa AA seqDB search
MKTGLILLMAISTVLMFSTVGSAQENSTDSAAAVLKDANGSTVGFATFTEDAFGMVRIQV
FASNLTPGLHGIHIHDKANCTGPSFASAGGHYNPLGKEHGLDNPKGPHAGDLPNFFVGQD
GTGYMDVTTNLVTLSPGKTTLFPANGTSLVIHADPDDQFTDPSGNSGARIVCGVIEKR
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactggattgatattactgatggctatctcgacagtactgatgttttcaactgtg
ggctccgcccaggaaaactctacagacagtgctgcagctgttctgaaggacgcgaatggc
agtactgtagggttcgccacctttaccgaggacgcctttggcatggttcgaattcaggtc
tttgctagcaacctgacaccgggcctgcacggcatccacatccacgataaagcgaattgc
acaggaccgtcttttgcctctgcaggcggacactataatcctctgggcaaagaacatggg
cttgacaatccgaaaggtccccatgccggtgatctacccaatttcttcgtggggcaggat
ggtacgggatatatggacgtcactactaaccttgtgacgctgtcacccggaaagaccacg
ctatttccggccaacggtacctcactggtcatccatgccgatcctgacgaccagttcact
gatccttccggcaacagtggtgcccggattgtctgtggagtcatcgaaaaaagataa

DBGET integrated database retrieval system