KEGG   Methylobacterium sp. 4-46: M446_1732Help
Entry
M446_1732         CDS       T00679                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
met  Methylobacterium sp. 4-46
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:met00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    M446_1732
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    M446_1732
Enzymes [BR:met01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     M446_1732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
1947301..1948572
Genome map
AA seq 423 aa AA seqDB search
MQPVPAPPARIEADYLLESVVDPRRAAEIIAGEQSSGTFVPVPGETPELKARAAARIERL
DLLDEAVAAPALPSAGIPAGAAARRARLTLSWPLDNLGPSLPNLLATVAGNLFELKPVTG
LRLLDIRLPEAFARAYPGPRFGVAGTRRLAGIEGRPLIGTIIKPSVGLDPQQTAALVASL
CAGGIDFIKDDELQADGPHCPFDARVRAVMREVRAHRDRTGRAVMVAFNLTGDLDQMRRR
HDLLVAEGATCLMASLNSVGLVGMIELGRFSALPIHAHRNGWGYLSRHPLLGWSYVAWQK
IWRLAGADHMHVNGLANKFAEPDDSVVASARTCLTPLFPDKPCLAMPVFSSGQSVRQAPG
TYRALGGTDLIVTAGGGIMAHPGGPAAGVEALREAWEAAVAGIPLDAYARERPALRDALG
AAA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcccgtccccgccccgccggcccggatcgaggccgattacctgctggagagcgtc
gtcgacccgcgccgggccgccgagatcatcgcgggcgagcagtcgagcggcaccttcgtg
cccgtcccgggcgagacgcccgagctgaaggcgcgcgccgccgcccggatcgagcgcctc
gacctcctcgacgaggccgtcgccgcgcccgctctgccctccgccggcatcccggccggg
gcggcggcccggcgcgcccgcctcaccctgtcctggcccctcgacaatctcggcccctcg
ctgccgaacctcctcgccacggtggccggcaacctgttcgagctgaagccggtcacgggc
ctgcgcctcctcgacatccgccttccggaggccttcgcgcgggcctatccggggccgcgc
ttcggcgtcgccggcacccgccgcctcgccggaatcgagggccggccgctcatcggcacc
atcatcaagccgagcgtcggcctcgacccgcagcagaccgccgccctggtcgccagcctc
tgcgcgggggggatcgacttcatcaaggacgacgaattgcaggccgacgggccgcactgc
cccttcgacgcgcgggtgcgcgccgtgatgcgggaggtgcgcgcccaccgggaccgcacg
ggccgggccgtgatggtggccttcaacctcaccggcgacctcgaccagatgcgccgccgg
cacgacctgctcgtcgcggagggcgccacctgcctgatggcgagcctcaactccgtcggc
ctcgtcggcatgatcgagctcgggcgcttcagcgccctgccgatccacgcccaccgcaac
ggctggggctacctctcgcgccacccgctgctcggctggtcctacgtggcgtggcagaag
atctggcgcctcgccggcgccgaccacatgcacgtcaacggcctcgccaacaagttcgcg
gagccggacgacagcgtcgtcgcctcggcgcgcacctgcctgacgccgctcttccccgac
aagccctgcctcgccatgccggtcttctcctccggccagtcggtgcggcaggcccccggc
acctaccgggcgctcggcgggaccgacctcatcgtcacggcgggcgggggcatcatggcg
catccgggcgggccggcggcgggcgtcgaagccctgcgcgaggcctgggaggcggcggtg
gcgggcatccccctcgacgcctacgcgcgcgagcgcccggccctgcgcgacgcgctcggg
gccgccgcgtga

DBGET integrated database retrieval system