KEGG   Methylobacterium sp. AMS5: Y590_08610Help
Entry
Y590_08610        CDS       T04283                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
meta  Methylobacterium sp. AMS5
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Formaldehyde assimilation, serine pathway
Brite
KEGG Orthology (KO) [BR:meta00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Y590_08610
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Y590_08610
   00680 Methane metabolism
    Y590_08610
Enzymes [BR:meta01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Y590_08610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1839178..1841946
Genome map
AA seq 922 aa AA seqDB search
MTKTLHARPSAATDTTFAPPVITGTATEDALDILFHALLDVARRHEPELEDVLHGRADIS
SFTPEMLARALQVQGIWFQLVSIAEQNAAMRRRRHVERDQGREALNGSFAKVLAEASARG
IGPQRIHALLKDLRIRPTITAHPTEGKRVTVLEKLRRIYLVLRELELPRWTERERNGLMN
ELRDQIELIWMTGELHLEKATVEREVAWGLHFFDETLFEMLPEMLLSLEESLAQYYPDET
FEVPPFFQFGSWIGGDRDGNPYVTASVTRETLQRNALASLRRYRDGITHLGRVLSITERS
LPVPETFRSELAHMLAESGEARAIANRNPGEAYRQFLSCVLRKLEATIARNKGARSVGPD
YPSADGLINDLRTLEKGLADAKCGALATDIVRPVRRMVEIFRFSTVRLDLRENSTRTTKT
LHALWKLRNGDREPPALDSPAWKEWLLTELARPRTPETAFEDFADRLPDDARETLATFAL
VGEMRDTLDREAFGAFILSMTRSTVDVLGAYLLAKEAGIFLDATGTEICPLPIVPLFETI
DDLRAAPAIMKELLGIPVVRRSTRWQGGVQEVMIGYSDSNKDGGFIASNWELYKAQVRLT
VLGNHLGVPIAFFHGRGGSVSRGGVPTHRGIAAQPPGSIQGRFRITEQGEVVSFKYANRG
TAAYQMELLAASVFEHALLSEGNGNGSRAEFDDALEALSGASRAAYVNLLQAEGLVDYFQ
AASPLDEISLLNIGSRPARRFGAKSLSDLRAIPWVFAWSQNRHVITGWYGVGSGLKSFID
VRGEAGEALLKRLFRDCRVFRLVLDEVEKTLLMVDLEIARDYAGLVEDEAVRARIFGMIE
AEYALTREMVLRVSGDSELAQRFPQFSERLRGRLPTINQVSREQVELLRRYRSETDEDKR
EAVKSALLLSINCIAVGFGATG
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagacgctgcacgcccggccgtcagccgcgaccgacacgaccttcgcgccgccg
gtcatcaccggtacagccaccgaggacgccctcgacatcctgttccacgccctgctcgac
gtggcccgccgccacgagcccgagctggaggacgtgctgcatggccgcgccgacatctcc
tccttcacgccggagatgctggcgcgcgcgcttcaggtgcagggcatctggttccagctc
gtctcgatcgcggagcagaacgcggccatgcgccgccgccgccacgtcgagcgcgaccag
ggccgcgaggcgctgaacggctccttcgccaaggttctggccgaggcctccgcccggggc
atcggcccgcagcggatccacgcgctgctcaaggacttgcgcatccgcccgaccatcacc
gcgcatcccaccgagggcaagcgcgtgacggtgctggagaagctgcgccggatctacctc
gtgctgcgcgagctggaactgccgcgctggaccgagcgcgagcgcaacggcctgatgaac
gagctgcgcgaccagatcgagctgatctggatgacgggtgagctgcatctggagaaggcc
accgtcgagcgcgaggtcgcctggggcctgcacttcttcgacgagaccctgttcgagatg
ctgcccgagatgctgctctcgctcgaagagagcctcgcgcagtactatcccgacgagacc
ttcgaggtgccgccgttcttccagttcggaagctggatcggcggcgaccgcgacggcaac
ccctacgtcacggcgagcgtgacccgcgagacgctccagcgcaacgcgctggcatcgctc
cgtcgctaccgcgacggcatcacccatctcggccgggtgctctcgatcaccgagcgctcg
ctgccggtgcccgagaccttccgcagcgaactcgcgcacatgctggccgagtccggcgag
gcgcgggccatcgccaaccgcaatcccggcgaggcctaccgccagttcctctcctgcgtg
ctgcgcaagctcgaagcgacgatcgcccgcaacaagggcgcccgctcggtcgggccggat
tatccgagcgcggacgggctcatcaacgatttgcgcaccctcgagaaggggctggccgac
gccaagtgcggcgcgctcgccaccgacatcgtgcggcccgtgcggcggatggtcgagatc
ttccgcttctccaccgtacggctcgatctgcgcgagaactcgacccgcaccaccaagacg
ctgcacgcgttgtggaagctgcgcaacggcgaccgcgagccgccggcgctggattcgccc
gcctggaaggagtggctgctcaccgagctggcccggccgcgcacgcccgaaaccgcgttc
gaggatttcgccgaccgtctgcccgacgacgcgcgcgagacgctcgccaccttcgcgctg
gtcggcgagatgcgcgataccctcgaccgcgaggccttcggcgccttcatcctgtcgatg
acgcgctccaccgtcgacgtgctcggcgcctacctgctggccaaggaggccggcatcttc
ctcgacgcgaccggcaccgagatctgcccgctgccgatcgtaccgctgttcgagaccatc
gacgacctgcgcgccgccccggcgatcatgaaggagctgctcggcatccccgtggtgcgc
cgctccacccgctggcagggcggggttcaggaagtgatgatcggctactccgactccaac
aaggacggcggcttcatcgcttcgaactgggagctctacaaggcgcaggtgcggctgacc
gtgctcggcaaccatctcggcgtgccgatcgccttcttccacggccgcggcggttcggtg
agccgcggcggcgtgccgacccatcgcggcatcgccgcccaaccgccgggctcgatccag
ggccgcttccgcatcaccgagcagggcgaggtcgtctcgttcaaatacgccaaccgcggc
accgccgcctatcagatggagctgctggcggcctcggtgttcgagcacgccctgctctcg
gagggcaacggcaacggctcgcgcgccgagttcgacgacgccctggaagcgctctcgggc
gcctcgcgggcggcctacgtcaacctcctccaggccgagggcctcgtcgattacttccag
gcggcgagcccgctcgacgagatctcgctgctcaatatcggctcgcgcccggcccggcgc
ttcggcgccaagtcgctctcggatctgcgcgcgatcccctgggtgttcgcgtggtcgcag
aaccggcacgtcatcaccggctggtacggcgtcggctcgggcctgaagagcttcatcgac
gtgcgcggagaggcgggcgaagccctgctgaagcgcctgttccgggattgccgggtgttc
cgcctcgtcctcgacgaggtcgagaagacgctgctgatggtcgatctcgagatcgcccgc
gactatgccggcctcgtcgaggacgaggccgtccgcgcgcgcatcttcggcatgatcgag
gcggaatacgcgctgacgcgggaaatggtcctgcgggtgtcgggcgacagtgaactcgcc
cagcgcttcccgcaattcagcgaacgcctgcgcgggcggctgccgaccatcaatcaggtc
agccgcgagcaggtcgagctcctgcgccgctaccgcagcgagaccgacgaggacaagcgc
gaggcggtgaagtccgcgctgctgctgtcgatcaactgcatcgccgtcggcttcggcgcg
actggataa

DBGET integrated database retrieval system