KEGG   Methylobacterium sp. AMS5: Y590_20035Help
Entry
Y590_20035        CDS       T04283                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
meta  Methylobacterium sp. AMS5
Pathway
meta00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:meta00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Y590_20035
Enzymes [BR:meta01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Y590_20035
Transporters [BR:meta02000]
 Other Transporters
  Pores ion channels [TC:1]
   Y590_20035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C Tom37 GST_C_3
Motif
Other DBs
NCBI-ProteinID: AMB47237
UniProt: A0A0X1SMR4
LinkDB All DBs
Position
complement(4318278..4318919)
Genome map
AA seq 213 aa AA seqDB search
MSDDLVFYTNPMSRGRIVRWMLEEVGAPYRTEILGYGASMKAPAYRAINPMGKVPALRHG
ETVVTECPAILAYLADAFPQAGLAPEPGHRDRGPYYRWLFFCAGPLEAAVTNGVLKVSVP
DDPRMQGMVGYGSLETALDTLEGAVSGAEFVAGDRFSAADLYVAAHLGWGMQFGTIPKRP
AFEAYAGRHLARAAAVRAREIDDGLLADAQKAP
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacgatctcgtcttctacaccaacccgatgtcccgcggccggatcgtccgctgg
atgctggaagaggtcggcgccccctaccgcaccgagatcctcggctacggcgcctccatg
aaggcaccggcctaccgggcgatcaacccgatggggaaggtgccggcgctgcgccacggc
gagacggtggtgaccgagtgccccgcgatcctcgcctatctcgccgacgctttcccgcag
gccggactcgcccctgagccgggccaccgcgaccgcggcccctattaccgctggctgttc
ttctgcgccgggcccctcgaggcggcggtgacgaacggggtgctcaaggtgagcgtcccc
gacgacccgcgcatgcagggcatggtcggctacggcagcctggagacggccctcgacacg
ctcgaaggcgccgtctccggcgcggaattcgtggcgggcgatcggttcagcgccgccgac
ctctatgtcgccgcgcatctcggctggggcatgcagttcggcacgatcccgaagcggccc
gccttcgaggcctatgccgggcgccacctcgcccgcgcggcggccgtccgcgcgcgtgaa
atcgacgacgggcttctcgccgacgcgcagaaagcgccgtga

DBGET integrated database retrieval system