KEGG   Methyloversatilis sp. RAC08: BSY238_2762Help
Entry
BSY238_2762       CDS       T04449                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase family protein
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
metr  Methyloversatilis sp. RAC08
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Formaldehyde assimilation, serine pathway
Brite
KEGG Orthology (KO) [BR:metr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSY238_2762
  Energy metabolism
   00680 Methane metabolism
    BSY238_2762
Enzymes [BR:metr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BSY238_2762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2971600..2974437)
Genome map
AA seq 945 aa AA seqDB search
MPAGSVVPDLTDLLEGLHVNQQAQTPVATHERAAHDKDQPLFDDIRLLGRMLGDVVREQE
GSRMFEIIENVRQLCVRFRRDDDLEARAELAKLLNSLSDDDTIIVVRAFSYFLHLANIAE
DQHHIRRARAHAIAGDAPRPGTLANALGKALDAKVPAEEILGFFRDALVVPVLTAHPTEV
QRKSILSQEMKIARLIDERDRTRLTPEELAEHDEAVRRTITSLWQTRMLRRTRLSVADEV
INGLSFYDYTFLRELPRVYNAVEDQLEAAFPEHKRVIGSFLRMGSWIGGDRDGNPFVTAD
VLRSTLRVQSARALDYYLTQVHILDTDLCSTMMLNNVSDELRVLAATAPDKSPHREDELY
RRALAGIYARLAATARTLDQHEALWKAVGDADPYRNAAEFVRDLDVIHDSLIGHKSRLIA
RGRLRRLRHAARVFGFHLAALDLRQNSDVHERVIAELLANAHVCNNYLELREEQRIEILI
NELGTPRPLTSSFMQFSEETAGELAIARTAAQMHALYGPEALPNYIISKADGVSDMLEVA
LILKEVGLLNVHERRAAMNIIPLFETIGDLRNAPRVMDRIFTIPIWRVLLDARSTTQEVM
LGYSDSNKDGGFLTSGWELYKAETKLVQVFKRHGVRLRLFHGRGGSVGRGGGPSFQAILA
QPAGAVQGQIRVTEQGEVIASKYSNPDVGRRNLEVLAAATFEATLLGKREGDAPPEFTDA
MEELSGYAFKAYRNLVYETEGFEKYFWESTVISEIAELNIGSRPASRKKGQKIEDLRAIP
WVFSWSQCRLMLPGWYGFGTAVNEYRAKHADGLARLQAIVHEWPFFATLISNIDMVLSKT
DIAIASRYAELVEDEALRTAIFSRIRAEWQATLDAVSQITGAPELLSTNPLLARSIRNRF
PYMEPLNHLQVELLRRFRSGNRHERTRRSIHLTINGVAAALRNSG
NT seq 2838 nt NT seq  +upstreamnt  +downstreamnt
atgccggccggcagcgttgttcccgacctgaccgatcttctggaaggattgcacgtgaat
caacaggcccagacgcccgttgcgacgcacgaacgcgccgcacacgacaaggaccagccg
ctgttcgacgatatccgcctgctcggccgcatgctgggcgacgtggtacgcgagcaggaa
ggcagccgcatgttcgaaatcatcgagaacgtgcgccagctgtgcgtgcgcttccgccgc
gatgacgacctcgaagcgcgcgccgaactggccaagctgctgaacagcctgagcgacgac
gacaccatcatcgtggtgcgcgccttcagctacttcctgcatctggccaacatcgcggaa
gatcagcatcacatccggcgcgcccgggcgcacgccatcgccggcgacgcacctcggccc
ggtacgctggccaatgcgctgggcaaggcgctcgacgccaaggtgccggcggaagagatc
ctcggcttcttccgcgacgcgctggtggtgccggtgctgaccgcgcatccgaccgaggtg
cagcgcaagagcatcctcagccaggaaatgaagattgcccggctgatcgacgagcgcgac
cgcacccgcctgaccccggaagagctggccgaacacgacgaagcggtgcggcgcaccatc
acttcgctgtggcagacccgcatgctgaggcgcacccgcctttcggtcgccgacgaggtg
atcaacgggctgtccttctacgactacaccttcctgcgcgaactgccgcgcgtctacaac
gcggtcgaggaccagctcgaagcggcctttccggagcacaagcgcgtcatcggcagcttt
ctgcgcatgggctcctggatcggcggcgaccgcgacggcaaccccttcgtcaccgccgac
gtgctgcgctcgacgctgcgcgtgcagtcggcccgcgcgctcgactattacctgacgcag
gtgcacatcctcgataccgacctgtgttcgacgatgatgctgaacaacgtcagcgacgaa
ttgcgcgtgctggccgccactgcaccggacaagtcgccgcaccgcgaggacgaactgtac
cggcgcgcgctggccggcatctatgcccggctggccgccaccgcgcgcacgctcgaccag
catgaggcgctgtggaaggcggtcggcgacgccgatccctatcgcaacgccgccgaattc
gtgcgtgacctcgacgtgatccacgattcgctgatcggccacaagtcgcgcctgatcgca
cgcggccggttgcgccgcctgcgccacgcggcacgcgtgttcggcttccatctggctgcg
ctcgacctgcggcagaactccgatgtgcatgagcgcgtgatcgccgaactgctggccaac
gcgcacgtgtgcaacaactacctcgagctgcgcgaagagcagcgcatcgagatattgatc
aacgagctgggcacgccgcgaccgctgacttcgagtttcatgcagttttcggaagagacc
gcgggcgagctggcgatcgcccgcacggcggcgcagatgcatgcgctgtacggcccggaa
gcgctgccgaactacatcatttccaaggccgacggcgtgtccgacatgctggaagtggcg
ctcatcctgaaggaagtcgggctgctgaacgtgcatgagcggcgcgccgcgatgaacatc
attccgctgttcgaaaccatcggcgacctgcgcaatgcaccgcgcgtgatggaccgcatc
ttcaccatcccgatctggcgcgtgctgctcgacgcccgctcgacgacgcaggaagtgatg
ctgggctattccgattcgaacaaggacggcggcttcctgacttcgggctgggagctttac
aaggcggaaacgaagctggtgcaggtgttcaaacggcacggcgtgcggctgcgcctgttc
cacggtcgcggcggttcggtcggccggggtggcgggccgagcttccaggccatccttgcg
cagccggccggcgcggtgcagggccagatccgcgtcaccgaacagggcgaggtgatcgcg
tcaaagtactccaacccggatgtcggccgccgcaacctggaagtgctggccgccgccacc
ttcgaggcgacgctgctgggcaagcgcgaaggcgatgcgccgccggaattcaccgacgcg
atggaagagctgtcaggctatgccttcaaggcctaccgcaatctggtgtacgaaaccgaa
ggtttcgagaagtacttctgggaatcgacggtcatttcggaaatcgccgagctgaacatc
ggctcgcgcccggcctcgcgcaagaagggccagaagatcgaagacctgcgcgcgattcca
tgggtgttttcgtggtcgcagtgccgcctcatgctgcccggctggtacggcttcggcacc
gcggtgaacgaatatcgcgccaagcacgccgacggtctggcgcggctgcaggccatcgtg
cacgagtggcccttcttcgcgacgctgatttccaatatcgacatggtgctgtcgaagacc
gacatcgcgatcgccagccgctacgccgagctggtcgaggacgaggcgctgcgcacggcg
attttctcgcgcatccgcgccgagtggcaggccacgctggacgcggtgagccagatcacc
ggcgcgccggaactgctgtccaccaatccgctgcttgcccgctcgatccgcaatcgcttc
ccctacatggagccgctgaaccacctgcaggtcgaactgctgcgccgtttccgcagcggc
aaccgccacgagcgcacgcgccggtcgatccacttgacgatcaacggggtggctgcggcg
ctgcgcaacagcgggtag

DBGET integrated database retrieval system