KEGG   Methanocella conradii: Mtc_2068Help
Entry
Mtc_2068          CDS       T01774                                 

Definition
(GenBank) DNA ligase D, 3'-phosphoesterase domain protein
Organism
mez  Methanocella conradii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1963523..1964020)
Genome map
AA seq 165 aa AA seqDB search
MPEHPIYVIQKHAASHLHYDFRLEVCGVLKSWAIPKGPSTDPRVKRLAMPTEDHPLEYAT
FEGVIPEGQYGAGTVMVWDIGTYRNLRGDEADMEQAYGEGRIEVWLEGRKLKGGYALIRA
GRMGDKRGWLLIKMRDEYANKPEDPAVTEPDSALTGRTLEEISGG
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgccggagcatcccatttatgtcatccagaagcacgctgcaagccacctccattatgat
tttcgcctcgaagtgtgcggtgtgcttaagtcgtgggccataccaaaaggcccctcgacc
gaccccagggtgaaacggcttgccatgccaaccgaggaccatccgctggagtatgccacg
ttcgagggggtgatacctgaagggcaatatggcgcagggacggtcatggtatgggatata
gggacgtacaggaaccttcgcggcgatgaggctgacatggagcaggcctatggggagggc
aggatcgaggtatggctggaaggcaggaagctcaagggcggatatgcgctgatacgggca
gggaggatgggggataaaagaggatggcttctcataaagatgagggacgagtacgccaat
aagcccgaagaccccgctgtcaccgagcccgactccgcgctcaccgggcgcacgctcgag
gagatctcagggggctag

DBGET integrated database retrieval system