KEGG   Methanocaldococcus fervens: Mefer_1305Help
Entry
Mefer_1305        CDS       T00976                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
mfe  Methanocaldococcus fervens
Brite
Enzymes [BR:mfe01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Mefer_1305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_ligase DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: ACV25114
JGI: Mefer_1305
UniProt: C7P982
LinkDB All DBs
Position
1230989..1232161
Genome map
AA seq 390 aa AA seqDB search
MQVSAYALDKIAEKLNLSIKDLNKAFKKKILREDEYKEQKYLLFKKGFRGIEKGTVIFLN
ENLDVVRGYPKTYRAITLYPTIKNHFIDKVVVEEKLNGYNIRIVKVDDEIYALTRSGYIC
PFTTKKVKKFLNLEILDDYNEYMLCGEMIGLNNPYTPYYYKEADKGYENLGFYIFDIKER
ETNKSLPVKERMKLCEKYNLPYVKPLAIVDKETAHIQVRKIIEKLNKEGREGVVLKDPDM
AVSPIKYTTHYTQCEDLKSAFTFFFDLGIDFIFSRVVREGFMSYEFKESLEERKIRAKDL
GEAILLPMVETINKVANGERVSEDFELIFDSEEDFEEFLYFMRKMKMIINIKNVEEINTN
EGVKIKALIGKIYNRTNDKIISYLNGTLWE
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtttcagcatacgctttggataaaatagcagaaaaacttaatttgtccataaaa
gacttgaataaagcatttaaaaagaaaattttaagagaagatgaatataaagaacaaaaa
tacctgctatttaaaaaaggatttagggggatagaaaaagggacagtcatatttttaaat
gaaaaccttgatgtcgttaggggatatccaaaaacttatagggccataaccctctaccca
acaataaaaaatcattttattgacaaggttgttgttgaagaaaaattaaatggctacaac
ataaggatagttaaagtagatgatgagatttatgcgttaacaaggagtggttatatctgc
ccatttacaacaaaaaaagttaaaaaattcttaaatttggagattttagatgactacaat
gaatatatgctatgtggggagatgattgggctaaataatccatacactccttattattac
aaagaggccgataaaggatatgaaaaccttggattttacatatttgacataaaagagaga
gaaactaacaaatctctaccagtaaaagaaaggatgaagctatgtgaaaaatacaactta
ccttacgttaagcccttagcaattgttgataaagaaactgcccacatacaagtaagaaaa
attattgaaaaattaaataaagagggaagggagggagttgttttaaaagatcccgatatg
gccgtctccccaataaaatacacaacccattatacacaatgtgaagatttaaaatccgca
tttacatttttctttgatttaggtattgattttatattcagtagagttgtaagagaagga
tttatgagttatgagtttaaagaaagtcttgaagaaagaaaaataagggctaaagatttg
ggagaggcaattttgctaccgatggttgaaacaataaataaagtggctaatggggagagg
gtttctgaggactttgagttaatatttgatagtgaagaggattttgaggaatttctatat
ttcatgagaaagatgaagatgatcataaatataaaaaacgttgaagaaattaataccaat
gaaggagttaaaattaaagcgctgattggaaagatctacaatagaactaacgataaaatc
attagctatttaaatggaacgctctgggaataa

DBGET integrated database retrieval system