KEGG   Methanoregula formicica: Metfor_2181Help
Entry
Metfor_2181       CDS       T02392                                 

Definition
(GenBank) ribulose bisphosphate carboxylase, type III
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
mfo  Methanoregula formicica
Pathway
mfo00630  Glyoxylate and dicarboxylate metabolism
mfo01100  Metabolic pathways
mfo01120  Microbial metabolism in diverse environments
mfo01200  Carbon metabolism
Module
mfo_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:mfo00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Metfor_2181
Enzymes [BR:mfo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Metfor_2181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AGB03187
UniProt: L0HEQ2
LinkDB All DBs
Position
complement(2139359..2140651)
Genome map
AA seq 430 aa AA seqDB search
MAIDWYKEFVDLKYEPAKDDLVCLFYFEPAAGVSGREAAGRIASESSTGTWTTLFSMPPR
MKALQATAFHIEGNVVKIAYPIELWEEGNTVQLMSGIAGNIFGMKAVRNLRLIDVALPPA
YLKHFQGPHFGNDGIRKMMGIQKRPLTGAVPKPKIGFSAKEHADIGYETWMGGFDFVKDD
ENLTSTSFNKFEDRVKYMTKLRDKAEKETGEKKSAFLNITADVETMKKRADLLAANGWNY
CMIDVVVAGTAAVMTMRDYCSDLGLAIHAHRAMHAALDRNRKHGISMQFLAKIMRLIGVS
QIHTGTAVGKLTGSRKESLALANLLREKKTAAVEGMLLEQDWGKIKSAFPVSSGGLHPGL
VPDVMDIYGPEMVLLVSGGIHGHPKGTRAGAKATMQAMEAWQEGVSLEEKAKKAKELKEA
LGKWGHYKPI
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggcgattgactggtacaaggaattcgttgacctgaagtacgaaccggcaaaagatgac
ctcgtctgcctcttctatttcgagcccgcggcgggtgtcagcggcagggaagccgccggc
cggatcgcatcagagagttcgaccggcacgtggacaacgctcttctccatgcccccccgg
atgaaggccctgcaggcaacggcgttccacattgagggaaatgtcgtgaagatcgcatat
cccatcgagctctgggaagagggcaacacggtccagctgatgagcgggatcgcgggcaac
atcttcgggatgaaagcggtgaggaacctgcgccttatcgatgtcgcgcttcccccggca
tacctgaagcatttccagggcccgcacttcgggaacgacgggatccggaagatgatgggg
atacaaaagcgccccctcaccggcgctgtgcccaagccgaagatcgggttctcggcaaag
gagcatgccgatatcgggtacgagacctggatgggcggcttcgatttcgtcaaggatgac
gagaacctcacctccacctcgttcaacaaattcgaggaccgggtgaagtatatgacaaaa
ctccgggacaaggcggaaaaagagaccggtgagaagaagtccgcgttcttaaatataaca
gccgacgtcgaaacaatgaagaagcgggccgacctccttgctgctaatggctggaactac
tgcatgatcgatgtcgtggttgccggtaccgcggctgtcatgaccatgcgggactactgt
tctgatctcggccttgccatccacgcccaccgcgccatgcatgctgcgctcgaccggaac
cggaagcatgggatcagcatgcagttcctggcaaagatcatgcggcttatcggggtctca
cagatccacaccggtaccgcggtcgggaagctgaccggctcccgcaaggagtcgctcgcg
ctcgcgaacctgctgcgcgaaaagaagaccgcggcagttgagggaatgctgctcgaacag
gactggggcaagatcaaatcagcgttcccggtctcgtcaggcggcctgcatccgggcctg
gtgccggacgtgatggatatctacggccccgagatggtcctgctcgtctccggcgggatc
cacggccacccgaaggggacaagggccggcgcgaaggcgaccatgcaggcaatggaggca
tggcaggaaggagtatcccttgaggagaaggcaaagaaggcaaaagagctcaaagaggcc
ctcggcaagtggggccactataaacccatctga

DBGET integrated database retrieval system