KEGG   Mycobacterium fortuitum: XA26_15940Help
Entry
XA26_15940        CDS       T04105                                 

Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mft  Mycobacterium fortuitum
Pathway
mft00250  Alanine, aspartate and glutamate metabolism
mft00410  beta-Alanine metabolism
mft00430  Taurine and hypotaurine metabolism
mft00650  Butanoate metabolism
mft01100  Metabolic pathways
mft01110  Biosynthesis of secondary metabolites
mft01120  Microbial metabolism in diverse environments
mft02024  Quorum sensing
Module
mft_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mft00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    XA26_15940
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    XA26_15940
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    XA26_15940
   00430 Taurine and hypotaurine metabolism
    XA26_15940
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    XA26_15940
Enzymes [BR:mft01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     XA26_15940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 DUF2378
Motif
Other DBs
NCBI-ProteinID: ALI25441
UniProt: A0A0N9YEC7
LinkDB All DBs
Position
1627862..1629244
Genome map
AA seq 460 aa AA seqDB search
MPHKHHRAPHISPAYTGRLAMAPVPSLRLPDDAMEPGAAYRFIHDELMLDGSSRLNLATF
VTTWMDPEAEKLMADTFDKNMIDKDEYPATAAIEARCVSMVADLFHAEGLSDDDASAACG
VSTIGSSEAVMLGGLAMKWRWREKVGTDWKGRTPNLVMGANVQVVWEKFCRYFDVEPRYL
PMENGRYVITPEQVLDAVDEDTIGVVAILGTTYTGELEPIAEICAALDQLSQDKGLDIPV
HVDAASGGFVVPFLHPDLVWDFRLPRVVSINVSGHKYGLTYPGIGFVVWRSKEYLPEDLV
FRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGRAGYTQVMQCLSQTARWLGDELRDS
EHFELITDGSAIPVVSFRLKGKPGYTEFDVSEGLRSFGWQVPAYTMPEGATDVVVLRVVV
REGFSADLARALKEDTITVLGRLDALKPRGAFNDLQPFAH
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgccgcacaagcaccatcgcgccccgcatatttcaccggcctacaccggcaggctggcg
atggcgccggttccctcgctgcgcctgcccgacgacgcgatggaacccggtgcggcgtac
cgcttcatccacgacgagctcatgctcgacggcagctcgcggttgaacctcgcgacgttc
gtcaccacgtggatggaccccgaggccgagaagctcatggccgacacgttcgacaagaac
atgatcgacaaggacgagtatccggccaccgcggcgatcgaggcgcgctgcgtgagcatg
gttgccgacctgttccatgccgaagggctgagtgacgacgatgcgtcggccgcatgcgga
gtctccacgatcggctccagcgaggcggtgatgctcggcgggctggccatgaaatggcgg
tggcgtgaaaaggtcggaacggactggaaggggcgtacgcccaatctggtgatgggtgcc
aacgtccaggtggtctgggagaagttctgccggtacttcgacgtcgaaccgcgctacctg
cccatggagaacgggcgctacgtgatcacccccgagcaggtgctcgacgcggtcgacgag
gacaccatcggtgtcgtcgcgatcctgggcaccacctacaccggggagctggagccgatc
gcggaaatctgcgcggccctggaccagctgtcgcaagacaagggcctggacatccccgtg
cacgtcgacgccgcgagcggcggattcgtcgtcccgttcctgcaccccgacctggtgtgg
gatttccggttgccgcgcgtggtgtcgatcaacgtcagcggtcacaagtacggcctgacc
tacccgggcatcggtttcgtggtgtggcgcagcaaggagtacctgcccgaggacctggtc
ttccgggtcaattacctcggtggggacatgccgaccttcaccctgaacttctccaggccc
ggcaaccaggtggtggggcagtactacaacttcctgcggctgggccgggccgggtacacc
caggtgatgcagtgcttgtcacagacggcgcgctggctgggcgacgagcttcgcgacagt
gagcacttcgagctgatcaccgatggttcggccatcccggtggtcagcttccggctcaag
ggaaagccggggtacaccgagttcgacgtgtcggaggggctgcgctccttcggctggcag
gtgccggcctacaccatgcccgagggcgccaccgatgtcgttgtgttgcgggtggtcgtg
cgcgagggattctcggccgatctggcccgcgcgctcaaggaggacaccatcacggtgctc
gggcgactcgacgcgctcaagccgcgtggggcgttcaacgacctgcagccgtttgcgcac
tag

DBGET integrated database retrieval system