KEGG   Myxococcus fulvus: LILAB_25885Help
Entry
LILAB_25885       CDS       T01558                                 

Definition
(GenBank) peptidyl-dipeptidase A
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
mfu  Myxococcus fulvus
Brite
Enzymes [BR:mfu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     LILAB_25885
Peptidases [BR:mfu01002]
 Metallo Peptidases
  Family M2
   LILAB_25885
Exosome [BR:mfu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LILAB_25885
CD molecules [BR:mfu04090]
 Proteins
  LILAB_25885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
6120738..6122624
Genome map
AA seq 628 aa AA seqDB search
MNRKRPLNSLLRAAAAMALPAFLGCAQDSQVTREAPAPAESSTPTAPTASQPTPEEAKAF
AEKVNADLKRLWTKQATAEWIKSTYITDDTEQNAAFVNEEVLAYVNGAIKEARRFDGLTL
DADTARMLHLLKVSQALPAPSDAQKRAELAATAAKLEGLYGKGKYCGPDGKGKCRDLEVL
SDVIAESRDYDELLDAWQGWHSVARPMRPLYERLVSISNEGAKDIGFNDLGTLWRSAYDM
SPAEFEVEAQRLWGQVKPLYDDVHCYVRGRLAKQYGADKVPEGKPIPAHLLGNMWAQEWN
NIYPLVEPFPGQANLDVDAALKQQKYDAMRMVKLGEKFFTSLGLKPLPQTFFERSQFTKP
EGRDVVCHASAWDVNYSNDLRIKMCIKPTEEDLVTIHHELGHNYYYTYYYQLPVLFQAGA
NDGFHEAIGDALTLSITPGYLQQAGLLKSVPKNEKNLINLQMKDALEKIAFLPFGLLVDQ
WRWEVFSGRVQPADYNKSWWALREKYQGVAAPVARSEQDFDPGAKYHVPANVPYTRYFLA
RILQFQFHKALCEASGHTGPLHECSIYGNKEAGKRLQAMLELGASKPWPDALQAMTGTRQ
MDATPLLDYFSPLRTWLQAQNKGQKCGW
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggaaacgtcccctgaactccctgctgcgtgcggccgcggccatggcgctgccc
gccttcctggggtgtgcccaggattcgcaagtgacgcgtgaggcgcctgcccccgccgag
tcctccacccccaccgcccccaccgcgtcgcagcccacgccggaagaggcgaaggccttc
gcggagaaggtcaacgcggacctgaagcgcctgtggacgaagcaagccaccgcggagtgg
atcaagtccacgtacatcaccgacgacaccgagcagaacgccgccttcgtcaacgaagag
gtgctggcctacgtcaacggcgccatcaaggaagcgcgccgcttcgacggcctgacgctg
gacgcggacaccgcgcgcatgctgcacctgctcaaggtgtcccaggcgctgccggcgccg
tcggacgcgcagaagcgggccgagctggccgccacggcggcgaagctggaaggcctctac
ggcaagggcaagtactgcgggccggacgggaaggggaagtgccgcgacctggaggtgctg
tccgacgtcatcgcggagagccgcgactacgacgagctgctggacgcgtggcagggctgg
cactccgtggcccgccccatgcggccgctgtacgagcgcctggtgtccatctccaacgag
ggcgccaaggacatcggcttcaacgacctgggtacgctctggcgctccgcgtacgacatg
tccccggccgagttcgaggtcgaggcccagcgcctgtggggccaggtgaagccgctctac
gacgacgtgcactgctacgtgcgcggccggctggcgaagcagtacggcgccgacaaggtg
cctgaaggcaagcccatccccgcgcacctgctgggcaacatgtgggcgcaggagtggaac
aacatctacccgctggtggagcccttccccgggcaggccaacctggacgtggacgcggcg
ctgaagcagcagaagtatgacgcgatgcgcatggtgaagctgggtgagaagttcttcacc
tcgctgggcctcaagccgctgcctcagaccttcttcgagcgctcgcagttcaccaagccg
gaaggccgcgacgtcgtctgccacgccagcgcctgggacgtaaactacagcaacgatctg
cgcatcaagatgtgcatcaagcccacggaggaggacctcgtcaccatccaccacgagctg
ggccacaactactactacacgtactactaccagctcccggtgctcttccaggccggcgcg
aacgacggcttccacgaggccattggtgacgcgctgacgctgtccatcacccccggctac
ctccagcaggcggggttgttgaagtccgttcccaagaacgagaagaacctcatcaacctc
cagatgaaggacgccctggagaagatcgccttcctgcccttcggtctgctcgtggaccag
tggcgctgggaggtgttctccggccgcgtgcagccggcggactacaacaagtcctggtgg
gcgctgcgggagaagtaccagggcgtggccgcgccggtggcccgctccgagcaggacttc
gacccgggggcgaagtaccacgtgcccgcaaacgttccgtatacgcgttatttcctggcg
cgaatcctccagttccagttccacaaggcgctctgcgaggcgtccggccacacgggccct
ctccacgagtgctccatctacgggaacaaggaggccggcaagcggctccaggccatgctg
gaactgggcgccagcaagccctggcccgacgcgctccaggccatgacgggcacccggcag
atggacgccacgccgctgcttgactacttcagcccgctgcgcacctggctccaggctcag
aacaagggccagaagtgtggttggtaa

DBGET integrated database retrieval system