KEGG   Mycobacterium gilvum PYR-GCK: Mflv_1254Help
Entry
Mflv_1254         CDS       T00498                                 

Definition
(GenBank) ATP dependent DNA ligase
Organism
mgi  Mycobacterium gilvum PYR-GCK
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(1306721..1307821)
Genome map
AA seq 366 aa AA seqDB search
MAGMRLPVMPPLSPMLSKSVQQIPDGASYEPKWDGFRSIVFRDGDEIEFGSRNERPMTRY
FPELVAAARSELPPRCVVDGEIVIATAGGLDFEALQLRLHPAASRVTMLAEKTPASFIAF
DLLALGDTDLTGRPFTERRAALVDALAGAGPTFHVTPATRDIALATRWFDEFEGAGLDGV
IAKPVDGVYLPDKRTMFKIKHRRTADCVVAGYRLHKSGDDAVGSLLLGLYDSDGALASVG
VIGAFPMARRRALLAELQPLVTTFDEHPWNWAAHADPDVVRRHGGGSRWNAGKDLSFVPL
RPERVVEVRYDHMEGRRFRHMAQFNRWRPDRTPRSCTFDQLEQPVSFSLDDIGPGLTPRA
GRPYRS
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcggggatgcgcctacccgtgatgcccccgctctcaccgatgctctcgaagtcggtg
cagcagatcccggacggcgcctcgtatgaaccgaagtgggacggcttccggtcgatcgtg
ttccgtgacggcgacgagatcgaattcggcagccgcaacgaacgcccgatgacccgttac
ttcccggagctcgtcgcggcggcccgctccgagcttcccccgcgctgcgtcgtcgacggc
gagatcgtgatcgcaaccgccggcggactcgacttcgaagcgctgcagttgcgtctgcac
ccggccgcatcgcgggtcaccatgctggcggagaagaccccggcgtccttcattgcattc
gacctgctggcactcggcgacaccgacctgaccggccgcccgttcaccgaacggcgcgcg
gcactggtcgacgcgctcgccggtgccggaccgacgttccacgtcaccccggccacccgg
gacatcgcgctggccactcgatggttcgacgagttcgagggcgcgggcctggacggggtg
atcgccaagcctgtcgacggcgtctacctgccggacaagcggacgatgttcaagatcaag
caccggcgcaccgccgactgtgtggtcgcggggtaccggttgcacaagtccggtgacgac
gctgtcggctcgctgctgctcgggctctacgactccgacggcgcgctcgcgtcggtcggc
gtgatcggtgcgttcccgatggcgcggcgacgtgcgcttctcgccgaattgcagccgctg
gtgacgaccttcgacgagcatccgtggaactgggccgcgcacgccgacccggacgtcgtc
cgccggcacggcggcgggtcacggtggaacgccggcaaggacctgtccttcgtgccgctg
cgccccgaacgggtcgtcgaagtgcgctacgaccacatggagggcaggcggttccgccat
atggcgcagttcaaccggtggagaccggaccgcacgccgcgctcgtgcaccttcgatcag
ctcgagcagccggtgagtttcagcctcgacgacatcgggccgggcctcacgccgcgtgca
gggcgtccatataggtcgtga

DBGET integrated database retrieval system