KEGG   Mycoplasma gallisepticum NC06_2006.080-5-2P: HFMG06NCA_5020Help
Entry
HFMG06NCA_5020    CDS       T02200                                 

Gene name
tdk
Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
mgn  Mycoplasma gallisepticum NC06_2006.080-5-2P
Pathway
mgn00240  Pyrimidine metabolism
mgn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgn00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    HFMG06NCA_5020 (tdk)
Enzymes [BR:mgn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     HFMG06NCA_5020 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: AFP80023
LinkDB All DBs
Position
858797..859471
Genome map
AA seq 224 aa AA seqDB search
MAKKNAMTTTNGWIEAICGPMFAGKTDELIRKIKRYEYADVKSLVFSPATDTRSAQEIIN
SRDGRRIGSIKIKKAFEIYDYVLLHKPQLVGIDEVQFFDDSIVEVIQTLADNQINVIVAG
LDRDFRGEPFGPIPKILGIAESVIRLTAICSECGAEASRSQRLIDNQPADYNCETILIGD
TESYAPRCRHHHKVPNRPINDQTKNFKRALKNNFDKIVEQSSKD
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggctaagaagaacgcaatgaccaccactaatggttgaatcgaagcaatttgtggtccg
atgtttgctggtaaaacagatgaactaattcgcaagattaaacgttatgagtatgctgat
gtaaagtcgttggtcttttcaccagcaactgatactcgttcagctcaagagattatcaac
tctcgagatgggcgtagaattggttcaataaagatcaaaaaagcatttgaaatctatgat
tatgttttattacataaaccacaattagttggaattgacgaagtgcaattctttgatgat
tcaattgttgaagtcatccaaacattagctgataaccaaattaacgtaattgtggctggt
ttagaccgtgattttagaggtgaaccttttggtccaattcctaagattttaggaattgca
gaatcagtaatccgcttaaccgcaatctgttctgagtgtggtgctgaagctagtcgaagt
caacgtttaattgataaccaaccagctgactacaattgcgaaacgattcttattggtgac
actgaatcatacgcgccaagatgtcgtcatcaccataaagtgcctaaccggccaattaac
gaccaaaccaagaacttcaaacgtgcactaaaaaataattttgataaaatagtagagcaa
tcttcaaaagattaa

DBGET integrated database retrieval system