KEGG   Meleagris gallopavo (turkey): 100542794Help
Entry
100542794         CDS       T01523                                 

Gene name
HK1
Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00010  Glycolysis / Gluconeogenesis
mgp00051  Fructose and mannose metabolism
mgp00052  Galactose metabolism
mgp00500  Starch and sucrose metabolism
mgp00520  Amino sugar and nucleotide sugar metabolism
mgp00524  Neomycin, kanamycin and gentamicin biosynthesis
mgp01100  Metabolic pathways
mgp01200  Carbon metabolism
mgp04910  Insulin signaling pathway
Module
mgp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mgp_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100542794 (HK1)
   00051 Fructose and mannose metabolism
    100542794 (HK1)
   00052 Galactose metabolism
    100542794 (HK1)
   00500 Starch and sucrose metabolism
    100542794 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    100542794 (HK1)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100542794 (HK1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100542794 (HK1)
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     100542794 (HK1)
Membrane trafficking [BR:mgp04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    100542794 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 100542794
NCBI-ProteinID: XP_010712598
LinkDB All DBs
Position
8
AA seq 917 aa AA seqDB search
MIAAQLLAYYFTELKEDQVKKIDKYLYAMRLSDETLIDIMARFRREMKNGLSRDFNPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSYFRILRVKVSHEKKQTVQMESEIYNTPEDIMH
GSGTRLFDHVAECLGDFMEKQQIKDKKLPVGFTFSFPCRQSKLDEGILITWTKRFKASGV
EGADVVKLLNKAIKKRGDYDADIMAVVNDTVGTMMTCGFDDQRCEVGLIIGTGTNACYME
EMRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YMGELVRLILVKMAKEGLLFEGRITPELLTKGKFETKHVSAIEKSKEGLNKAKEILTRLG
VEPSHEDCIAVQHVCTIVSFRSANLVASTLGAILNQLRDNKGVGRLRTTVGVDGSLYKMH
PQYARRLHKTTRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLSEQHRLIDETLAEFKLT
HEQLLQVKKRMRTEMEAGLKKKSHETAKVKMLPTFVRSTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKRRTVEMHNKIYAIPIEVMQGTGEELFDHIVTCISDFLDYMGIKGARLPLGF
TFSFPCKQTSLDAGILLNWTKGFKATDCEGEDVVYLLREGIKRREEFDLDVVAVVNDTVG
TMMTCAYEDPNCEIGLIVGTGSNACYMEEMRNVEMVDGEQGRMCVNMEWGAFGDNGCLDD
IRTIYDKAVDDYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKRGFLFRGQISETLKTRH
IFETKFLSQIESDRLALLQVRTILQQLGLNSTCDDSIIVKTVCGAVSKRAAQLCGAGMAA
VVDKIRENRGLEHLEITVGVDGTLYKLHPHFSRIMHQTVKDLAPKCDVTFLLSEDGSGKG
AALITAVGCRLRDAEQN
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgcccagctcctggcctactacttcaccgagctcaaggaggaccaggtcaaa
aagatcgataaatacctttacgccatgcggctctctgatgaaactctgatagacatcatg
gctcgcttccggagagaaatgaagaatggcctctccagagattttaacccaacagctaca
gtgaaaatgctccctacctttgtgaggtctattcctgatggctcagagaaaggagatttc
atcgctctggatctcggcggttcttactttcgaattctgcgggtgaaagtgtcgcatgaa
aaaaagcagacagtacaaatggaaagtgaaatttataatacacctgaagatatcatgcat
ggcagtgggacacggctttttgatcatgttgctgaatgcctgggagactttatggagaaa
caacaaatcaaagacaagaagttaccggttgggtttaccttttctttcccgtgcagacaa
tctaagctggatgagggtattctgataacctggacaaagcgcttcaaagcgagcggagtg
gagggagcagatgttgtgaagctgcttaacaaggccatcaagaaacgtggggactacgat
gcagatatcatggctgttgtgaatgataccgttgggactatgatgacctgtggttttgat
gaccaacgttgtgaagttggcttgatcattggcactggcaccaatgcctgttacatggag
gagatgcggcacattgacctggtggaaggggatgagggcaggatgtgcataaacacagaa
tggggggcctttggggatgacggctcactagaagacatcaggacagagttcgatagagag
atcgaccgtggatccctcaatcctggcaagcaactgtttgagaagatggtcagcgggatg
tacatgggggagctggtgagacttatcctggtgaagatggccaaggagggactgctcttt
gagggaagaatcacccctgagcttctcaccaaaggaaagtttgagacaaagcatgtttct
gccattgaaaagagcaaagaaggtttgaacaaagccaaagaaatcttaacccgcctgggg
gtggagccgtcccacgaggactgcatagcagtccagcacgtctgcaccatcgtgtccttc
cgctcggccaacctggtggcctccacgctgggtgccatcctcaaccaactgcgagataac
aaaggggttggtcgcctccgcaccactgtgggcgtcgatggctccctctacaagatgcat
ccacagtacgctcggcgcttgcacaaaaccacccggcgcctggtgcctgactcagatgtg
cggttcctgctgtcagagagtggcagtgggaaaggggcggcgatggtgacggcggtggcg
tatcggctgtcggagcagcaccggctcatcgatgaaacgctggctgagttcaagctcacc
catgagcagctgctgcaggtgaagaagaggatgaggacagagatggaagcaggcctgaag
aagaagagtcacgagactgccaaagtgaaaatgctgcccacctttgtccgcagcacgcca
gatggcacagagaatggagactttctggcacttgaccttggagggacaaacttcagagtg
ttgctggtgaaaattcgcagtggtaaaaggagaacagttgaaatgcacaacaagatctat
gcaatccctatagaggtgatgcagggaaccggagaagagctgtttgaccacatcgttacc
tgcatttcggacttcctggattatatgggaataaaaggtgcgcggcttcctcttggcttc
acgttctccttcccttgcaagcagaccagtctggatgctggtatccttctcaactggaca
aaaggattcaaagctacagactgtgagggagaagatgtcgtgtatttgctaagagaagga
attaaaagaagagaggagtttgacttggatgtagtagctgtagtgaatgatacagtgggc
acaatgatgacttgtgcttatgaagacccaaactgtgaaattggactcattgtgggaact
ggcagcaatgcctgttacatggaggagatgagaaacgtagagatggtggatggtgagcaa
ggacggatgtgtgtgaacatggagtggggagcgttcggggataatggatgcctggacgat
atcaggacaatatatgacaaagcagttgatgactattcactaaatgctggaaagcaaagg
tatgagaagatgatcagtgggatgtacctgggggaaatagtccgcaatattttgattgac
ttcaccaaacgagggttcctgttcagagggcagatttcagagacgctgaagaccaggcat
atctttgaaaccaagttcctttcacagattgaaagtgacaggttagccttgctgcaggtg
cgaaccattctccagcagctggggctcaacagcacgtgcgatgacagtatcattgtcaag
acagtgtgcggagcggtgtcgaagcgagcagctcagttgtgtggtgccggaatggctgca
gttgtagataaaattagggagaacagaggcttagagcacctggagataacggttggtgtg
gatgggactctgtacaaactacacccacacttttcgaggattatgcaccaaacagtcaaa
gacctggcacccaagtgtgatgtgactttcctgctctcggaggatggcagcgggaaaggg
gcagcactgatcacggcagtgggatgcaggcttcgtgatgccgagcagaactga

DBGET integrated database retrieval system