KEGG   Magnaporthe oryzae: MGG_02817Help
Entry
MGG_02817         CDS       T01027                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
mgr  Magnaporthe oryzae
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    MGG_02817
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MGG_02817
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MGG_02817
   00430 Taurine and hypotaurine metabolism
    MGG_02817
Enzymes [BR:mgr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     MGG_02817
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
7
AA seq 572 aa AA seqDB search
MVLSRHVNPDDIVQHLHNSSLKEQDGDNDTRTQAAISHLTPYSSRYASNVSLPKYKLPKE
GAEADTVYSMIRDELDLDGKPNLNLASFVGTYLEDNAQKLMVENIAKNLSDADEYPAMIS
MQQRCVSILAHLWNVQKGEKAIGSATTGSSEAIQLGGLAMKRRWQEARRAAGKDDSKPNI
IMGANAQVALEKFARYFDVEARILPVSEKSRYRLDADMVRDNIDENTIGIFIILGSTYTG
HYEPIEEISEILDKYQAETGHDIPIHVDGASGAFIAPFTHAQAGGPKWDFSLPRVKSINT
SGHKYGLVTAGVGWIVWRDESFLPKHLIFELHYLGGTEESYTLNFSRPGAQVITQYFNLV
HLGFSGYRAIMENCLANARLLSKSLEATGWYTCVSDIHRRVETAGSNGSNGKQKEPEVTP
EHAKETSADYVAGLPVVAFCFSDEFRRQFPHVKQETVSVLLRARQWIIPNYALPPNEEKT
EILRVVVRESMSLDLLDRLLSDICEVTQKLMDEDELDLNVLQGSRHKGPCTKADVSKEGR
AQAKKERDDRHKKHQATGRTGRMETGVHRSTC
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggtcctctcacgccatgtaaacccggacgacattgtccagcacctgcacaactcgtct
ttgaaggagcaggacggcgacaatgacacgcggacccaggctgcgatttcccacctgacg
ccgtactcgtctcgctacgcgagcaacgtgagcctgcccaagtacaagctccccaaggag
ggcgccgaggccgacacggtctactcgatgattcgcgatgagcttgacctggacgggaag
ccgaatctgaacttggccagcttcgtgggcacctacctcgaagacaatgcccagaagctc
atggtagagaacattgccaagaacctctccgatgcggatgagtacccagccatgatttcg
atgcagcagcgctgcgtgagcatcctggcccacctctggaacgtccagaaaggagagaaa
gcgattggcagcgcaaccacaggctcctcggaagccatccagctcggcggtctcgccatg
aagcgcaggtggcaggaggcgcggagggccgccggcaaggacgacagcaagcccaacatc
atcatgggcgccaacgcgcaggtcgccctcgagaagtttgcccggtactttgacgtcgag
gcgcgcatcctgcccgtgtcggaaaagagcaggtatcggctcgatgccgacatggtgcgc
gacaacattgacgagaacaccatagggattttcatcatcctgggcagcacctatacgggg
cattatgagcccatagaggagatttccgaaatcttggacaagtaccaggctgagactggg
catgatatcccaatccacgttgatggtgcaagcggtgcttttattgccccctttactcat
gcacaagctggtggacccaagtgggatttctcactccccagagtaaaatccatcaacacc
tcgggccacaagtacggccttgtgacggccggcgttggctggatcgtctggcgcgacgag
tccttcctgcccaagcacctcatcttcgagctgcactacctaggcggcaccgaggagtcg
tacacgctaaacttctcgcggcccggcgcccaggtcatcacgcagtactttaacctcgtc
catctgggcttctcgggctaccgggccatcatggagaactgcctggccaacgcgaggctg
ctgtccaaatctctcgaggcgacggggtggtatacctgcgtatccgacatccaccgccgc
gtcgagacggccggctccaacggcagcaacggcaagcagaaggagcccgaagtgacgccc
gagcatgcaaaggagacgtctgccgactacgtggccggcctgcccgtggtggcgttttgc
ttctcggacgagttccggcgccagttcccacacgtcaagcaggagacggtgtcggtgctg
ctccgcgcacgccagtggatcataccaaactacgcgctgccgcccaacgaggagaagacg
gagatcttgagggtcgtggtccgcgagagcatgtcgctggatctgctcgacaggctcctg
tccgacatttgcgaggtgacgcagaagctgatggacgaggacgagctcgacctcaacgtc
ttgcaagggagcagacacaaggggccttgtaccaaggccgatgttagcaaagaggggaga
gcccaggccaagaaggagagggacgatcgacacaagaaacaccaggccaccggcaggacg
ggcaggatggaaactggtgttcacaggtcgacctgttag

DBGET integrated database retrieval system