KEGG   Magnaporthe oryzae: MGG_10859Help
Entry
MGG_10859         CDS       T01027                                 

Definition
(RefSeq) heme peroxidase
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
mgr  Magnaporthe oryzae
Pathway
mgr00590  Arachidonic acid metabolism
mgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    MGG_10859
Enzymes [BR:mgr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     MGG_10859
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase p450
Motif
Other DBs
NCBI-GeneID: 2676375
NCBI-ProteinID: XP_003713235
UniProt: G4N2X9
LinkDB All DBs
Position
3
AA seq 1153 aa AA seqDB search
MDGAVRLDWTGLDLTGHEIHDGVPIASRVQVMVSFPLFKDQHIIMSSKESPSRKSSTIGQ
STRNGSCQADTQKGQLPPVGEKPKPVKENPMKKLKEMSQRPLPTQHGDGTYPTEKKLTGI
GEDLKHIRGYDVKTLLAMVKSKLKGEKLKDDKTMLMERVMQLVARLPTESKKRAELTDSL
INELWESLDHPPLNYLGPEHSYRTPDGSYNHPFNPQLGAAGSRYARSVIPTVTPPGALPD
PGLIFDSIMGRTPNSYRKHPNNVSSILWYWATIIIHDIFWTDPRDINTNKSSSYLDLAPL
YGNSQEMQDSIRTFKDGRMKPDCYADKRLAGMPPGVSVLLIMFNRFHNHVAENLALINEG
GRFNKPSDLLEGEAREAAWKKYDNDLFQVARLVTSGLYINITLVDYVRNIVNLNRVDTTW
TLDPRQDAGAHVGTADGAERGTGNAVSAEFNLCYRWHSCISEKDSKFVEAQFQNIFGKPA
SEVRPDEMWKGFAKMEQNTPADPGQRTFGGFKRGPDGKFDDDDLVRCISEAVEDVAGAFG
ARNVPQAMKVVETMGIIQGRKWNVAGLNEFRKHFHLKPYSTFEDINSDPGVAEALRRLYD
HPDNVELYPGLVAEEDKQPMVPGVGIAPTYTISRVVLSDAVCLVRGDRFYTTDFTPRNLT
NWGYKEVDYDLSVNHGCVFYKLFIRAFPNHFKQNSVYAHYPMVVPSENKRILEALGRADL
FDFEAPKYIPPRVNITSYGGAEYILETQEKYKVTWHEGLGFLMGEGGLKFMLSGDDPLHA
QQRKCMAAQLYKDGWTEAVKAFYAGMMEELLVSKSYFLGNNKHRHVDIIRDVGNMVHVHF
ASQVFGLPLKTAKNPTGVFTEQEMYGILAAIFTTIFFDLDPSKSFPLRTKTREVCQKLAK
LVEANVKLINKIPWSRGMFVGKPAKDEPLSIYGKTMIKGLKAHGLSDYDIAWSHVVPTSG
AMVPNQAQVFAQAVDYYLSPAGMHYIPEIHMVALQPSTPETDALLLGYAMEGIRLAGTFG
SYREAAVDDVVKEDNGRQVPVKAGDRVFVSFVDAARDPKHFPDPEVVNPRRPAKKYIHYG
VGPHACLGRDASQIAITEMFRCLFRRRNVRRVPGPQGELKKVPRPGGFYVYMREDWGGLF
PFPVTMRVMWDDE
NT seq 3462 nt NT seq  +upstreamnt  +downstreamnt
atggatggggctgtccggctcgactggactgggctggacttgactggacatgaaatacac
gatggcgttcccattgcgagtcgagtccaggtaatggtttcctttcccttgttcaaggac
caacacatcatcatgtcttccaaggagtcaccgagccgcaagagctcaaccattgggcag
tctaccaggaatggcagctgccaggctgacacgcaaaagggtcaactcccccccgtgggg
gagaagccgaaacctgtcaaggagaaccccatgaagaagctcaaggagatgtcccagcgt
ccactccccacgcagcacggcgacggaacatatcccaccgagaagaaattgactggtatc
ggggaggacctcaagcatattcgtggttacgatgtcaagactctcctcgccatggtcaag
tccaagctcaagggagagaagctaaaggacgacaagaccatgttgatggagcgggtgatg
cagctcgtcgctagactccctaccgagtccaagaagcgtgccgagctcaccgactcgctg
atcaatgagctatgggagtctctcgaccaccctccgctcaactatctcggccccgagcac
tcgtaccgcacgcctgatggaagctacaaccatcccttcaacccgcagctcggcgcggca
ggctcccgctacgcccggtccgtcatacccaccgtcacgcctccgggtgcgctgccagac
cctgggctgatctttgactcgatcatgggacgcacgccaaactcgtaccgcaagcatccc
aacaacgtctcatctattctgtggtactgggcgaccatcatcatccatgacatcttttgg
accgatcctcgcgacatcaacaccaacaagtcgtcgtcgtatctcgacctggcgcctctc
tacggcaacagccaggagatgcaggactcgattcgtaccttcaaggatggtcggatgaag
cccgactgctacgccgacaagaggcttgcagggatgccgcctggcgtcagcgtcctcttg
atcatgttcaaccgcttccacaaccacgtggccgagaaccttgccctgatcaacgagggt
ggcaggttcaacaagcccagtgacctgctcgagggggaggccagggaggctgcctggaaa
aagtacgacaatgacctgttccaggtggcacgtctggtgacctcgggtctgtacatcaac
atcaccctggtggattacgttcggaatattgtgaatcttaaccgtgtcgacaccacatgg
accctggacccccgccaagatgctggtgcccacgtcggtaccgctgacggagccgagcgg
ggcacgggcaacgccgtctcggccgagttcaacctctgctaccgttggcactcgtgcatc
tcggagaaggacagcaagtttgtcgaggcgcagttccaaaacatctttggcaagccggcc
tccgaggtccgtcccgacgagatgtggaagggctttgccaagatggaacaaaacaccccc
gcggaccccggtcagcgcacctttggcggcttcaagcgtggtcccgacggcaagtttgac
gatgacgatctcgtgcgctgcatttcagaggccgtcgaggacgtcgccggcgctttcggt
gcccgtaacgtgcctcaggccatgaaggttgtcgagaccatgggtatcattcagggcagg
aagtggaacgtcgccggtctgaacgagttccgcaagcatttccacctcaagccgtactcc
acctttgaggacatcaactcggatcctggtgtcgccgaggccctccgtcgtctttacgac
cacccggataacgtcgagctctaccctggtttggtggccgaggaggacaagcagcccatg
gtccctggtgtcggaatcgcacccacctacaccatcagccgtgtcgtgctttcggacgcc
gtgtgcctggtgcgtggagacaggttctacaccaccgactttacgcctcgcaacctgacc
aactggggctacaaggaggtcgactacgatctcagtgtcaaccacggttgtgtcttttac
aagctcttcatccgggccttccccaaccacttcaagcagaactcggtctacgcccactac
cccatggtggtcccgtcggagaacaagcgcatcctggaagccctgggccgtgcagacctg
ttcgactttgaagcccccaagtacatcccgccgcgcgtcaacatcacgtcgtacggtggt
gccgagtacatcctcgagacgcaggaaaaatacaaggtcacgtggcacgagggcctcggg
ttcctcatgggcgagggaggtctcaagtttatgctttcgggcgacgacccgctgcacgcg
cagcagaggaagtgcatggccgctcagctgtacaaggacggctggaccgaggcggtcaag
gccttttacgccggcatgatggaggagctgctcgtcagcaagagctacttcttgggcaac
aacaagcaccgccacgtcgacatcatcagggacgtcggcaacatggtgcatgtgcacttt
gccagccaggtctttggccttcccctcaagacggccaagaacccgaccggtgtcttcacc
gagcaggagatgtacggcatcctggccgccatcttcaccaccatcttcttcgacctcgac
ccgtccaagtcgtttcccctgcgcaccaagacccgcgaggtctgccaaaagctggccaag
ctggtcgaggccaacgtcaagctcatcaacaagatcccctggtccaggggcatgtttgtc
ggcaagccggccaaggatgagccgctgtccatctacggcaagaccatgatcaagggattg
aaggctcacggcctgagcgactacgacattgcctggagccacgtcgtccccacctcgggc
gccatggtccccaaccaggctcaggtgtttgcccaagctgtcgactactacctgtctccc
gccggcatgcactacattcccgagatccacatggttgccctccagccgtccacccccgag
actgatgcgctcctgctaggctacgccatggaaggtatccgacttgctggaacctttggt
tcgtacagggaggctgccgtcgacgacgtggtgaaggaggataacggccgccaggtgcca
gtcaaggctggcgaccgcgtctttgtatcctttgttgatgccgcgcgtgaccccaaacac
ttccccgacccagaggtggtcaacccccgccgccccgccaaaaagtacattcactacggc
gttggcccccacgcatgcctgggcagggatgccagccagattgccatcaccgagatgttc
cggtgcctgttccgccgcaggaacgtcaggagggtgccgggaccccagggagagctgaag
aaggtgccccgtcccggcggcttctatgtctacatgagggaggactggggtggcttgttc
cccttccccgtcaccatgcgggttatgtgggatgacgagtag

DBGET integrated database retrieval system