KEGG   Magnaporthe oryzae: MGG_12899Help
Entry
MGG_12899         CDS       T01027                                 

Definition
(RefSeq) DNA ligase 4
  KO
K10777  
DNA ligase 4 [EC:6.5.1.1]
Organism
mgr  Magnaporthe oryzae
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    MGG_12899
Enzymes [BR:mgr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MGG_12899
DNA repair and recombination proteins [BR:mgr03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     MGG_12899
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3
AA seq 1001 aa AA seqDB search
MSRIKREDTSQEAVDEDSLQYSFGDAGLGEVDEKYPNRPRNHSQTLVFSELFTNLFNPLN
EHKNRRGPGGPAGRKGGPRLSPHEQRRLIIRRFIDRWRSEVGNDFYPALRLILPDKDRDR
GVYGLKESAIGKLLVKLIKIAPDSEDGQNLLKWKLPGQTFASRMAGDFAGRCFETLSKRQ
MRMTPGDMRIGEVNSLLDKLAAASGEAEQLPIFQTFYERMNAEEMMWLIRMILKAMKIGA
SERTFLYQWHPDAEALFNVSSSLRRVCWELYDPALRLEQEDTRVTLMQCFQPQLAQFQPH
SPNFATMVQDLGVTDEDRRFWIEEKLDGERMQLHMIDDDDHPGGKRFSFWSRKGKDYTYL
YGNGFQDDNSALTRHLSDAFDPRVSNLILDGEMVTWDPKIDKMVPFGTLKTAALLGQKTP
FDDTNERPLFRIFDILYLNDTALTKNSLQDRRKALAQVVRDVHRRLEIHPYEEATSADAV
EPLLRKVVADSSEGLVLKNPRSVYRLNSRNNDWIKVKPEYMSEFGESLDCVVIGGYYGSG
HRGGTISSFLCGLRVGENHIKAGANPEKCISFFKVGGGFKAEDYAQIRHLTEGKWMDWDP
KKPPSEFIELGGGEKYQYERPDVWIRPKDSIVVSVKAASIGASPQFAMQITLRFPRFRRL
RTDRTWDSALDVDDFMKLKEDAEQQVKEKKEMKIEDRKRRPQKRARREILIAGQDPDTAM
ADQKPAAGQAQTGRTRSVFEGRKFCVMTDCVKPIRKTKAQLESLIKAHGGTLSQQTDPQP
WKYLIADKYGIKVASLLKRDSEVDIIRPNWVLDCLDQDGVEFLLPFEEKHLLNASEATKQ
TAEFQVDEYGDSYMRAVDVDELKQIAEGIPKFEDADSFDVDEFLDSLESAGCEMTGLGFV
FRRCIVLVAGVAGTPKHYLDILRSYIRFGGGTVVDNLQSQGLTHVVVAGDSNEGAAAREL
AAELRHRISLLRRPPRLVTRQWVDESWKEKTLLDEEAYVPL
NT seq 3006 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgaattaaacgggaggacacctcccaagaggcggttgatgaagattccctgcaa
tacagctttggtgatgctggcttgggagaagtcgatgagaaataccctaatcgtccccgt
aatcactcccagacactggtcttctccgaactgttcacgaatctcttcaaccctttgaat
gagcacaaaaaccggagaggtcccggtggccctgcaggccgcaagggcggcccgaggctg
tctcctcacgaacaaagacgcctcatcatcagacgcttcatcgaccgctggcggtccgaa
gttggcaatgatttctacccggctctgcgactgatactgcccgacaaggaccgcgatcgc
ggtgtctacggcctcaaggaaagcgcaatcggaaagcttctagtgaagttgatcaagatt
gcaccagactcggaggatggtcaaaaccttctcaaatggaagctcccgggccagaccttt
gccagccgcatggcgggtgattttgccggcagatgctttgagacgctatccaaaagacag
atgcgcatgaccccaggggatatgcgtattggagaagtcaactcgctgctcgacaaactg
gcagccgcttcaggagaggccgagcagctacccatttttcaaaccttctatgagcgcatg
aatgcagaggagatgatgtggctcattcgcatgatcctcaaggccatgaagattggtgca
agcgaacgcacatttctatatcagtggcacccggacgccgaagctctgttcaatgtcagc
tccagcttgcgccgtgtgtgctgggagctgtatgatcccgcactccgtctggagcaggaa
gataccagagtgactttgatgcaatgctttcagccccagctggcccagtttcagcctcac
tcacccaactttgctacaatggtccaagacctcggagtcaccgacgaagaccggagattc
tggatcgaggaaaagttggatggcgagcggatgcaattgcatatgatagatgacgacgat
catccaggaggcaagcgcttctctttctggtctcgaaagggcaaggactacacctacctc
tacggcaatggatttcaagacgacaactccgcactgaccaggcatttatccgatgctttc
gacccgcgagtttccaatctgattttggacggcgagatggtcacttgggatccaaagatc
gacaagatggtaccttttggtacactcaagacggccgccttgctcggtcaaaagacacca
tttgacgacacaaacgagcggcccctcttccgcattttcgacatattgtatctgaatgac
acagcgctgaccaaaaactcgttgcaagatcgccgcaaggcgctagcccaggttgtccgt
gatgtccatcgtaggctcgaaattcatccctacgaggaagcaacttcggccgatgccgtc
gagccgctgttgcgcaaggttgtagctgattcctcggagggtcttgtgctgaagaatcca
agatcagtatatcgtctgaacagtcgaaataatgattggatcaaagtgaaaccagagtac
atgtctgagtttggcgagtcactggactgtgtggtcattggcggctattacggctcagga
catcggggcggtaccatctccagttttctttgtggcctcagagttggcgagaaccacatc
aaggccggtgccaatccagagaaatgcatcagttttttcaaggttggcggtggcttcaaa
gccgaggactatgcgcagatccgccatttgacagagggcaaatggatggactgggaccca
aagaagcccccaagcgagtttattgagctcggtggcggcgagaagtaccagtacgaacga
cctgacgtctggatccgaccaaaggactccatcgttgtctcggtcaaggcggccagcatc
ggcgcttcccctcagtttgccatgcagattaccctccgtttcccgaggttccgacggctg
cggaccgataggacatgggactctgctttggatgtagacgatttcatgaagctcaaagaa
gatgctgagcaacaagtcaaggagaaaaaggaaatgaagattgaagatcgtaagcgcagg
ccgcaaaagagggccaggcgcgagatcttgatcgctggacaagatccagacacagccatg
gctgatcaaaagcctgcagctgggcaggcacagacaggtcggacaaggagcgtgtttgaa
ggccgtaaattctgtgtcatgactgactgcgtcaaaccaattagaaagaccaaggctcag
ctcgagtctttgataaaagctcatggcggaaccctctctcagcagacggatccccagcct
tggaagtacttgatcgcggataaatatggcatcaaggtggcgagtcttctcaagcgtgac
agcgaggtggacattatcaggccaaattgggtcttggactgtcttgaccaagacggcgtt
gagtttctcctgcccttcgaggaaaaacatctcctcaatgcttcggaagctaccaaacag
actgctgagtttcaggtggatgagtacggcgacagctacatgcgcgctgtggatgttgat
gagttgaagcagatagcagaaggcattcccaagtttgaggacgcagacagctttgatgtc
gacgagtttctggatagcttggaatcagccggatgtgagatgacgggacttggcttcgta
ttcaggcgctgcatcgtactcgttgctggtgtggccgggacgccaaagcactaccttgac
atactacgaagctatatccgtttcggcggcgggaccgtggtggacaatttgcagtcgcaa
ggcctcacgcacgtcgtggtggcgggtgactctaacgagggggcggccgctagggagttg
gcagctgagttgaggcaccgcataagcctgttacgacggccgccgaggctggtcacgcgg
cagtgggttgacgagagctggaaggagaagactctactagacgaggaggcatatgtgccg
ttatga

DBGET integrated database retrieval system