KEGG   Magnetospirillum gryphiswaldense: MGMSRv2__1494Help
Entry
MGMSRv2__1494     CDS       T02960                                 

Gene name
alr
Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
mgy  Magnetospirillum gryphiswaldense
Pathway
mgy00473  D-Alanine metabolism
mgy01100  Metabolic pathways
mgy01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mgy00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    MGMSRv2__1494 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    MGMSRv2__1494 (alr)
Enzymes [BR:mgy01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     MGMSRv2__1494 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:mgy01011]
 Precursor biosynthesis
  Racemase
   MGMSRv2__1494 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: CDK98709
UniProt: V6EZS6
LinkDB All DBs
Position
1528906..1530018
Genome map
AA seq 370 aa AA seqDB search
MMTAHDRATGILSIDLDAIADNWRTLAAHAPNAEAAGVVKADGYGLGAAPVARALRKAGC
TTFFVATIDEGISLRPHVNDARILVLGGVLPGTGADFIGHQLIPVLNSPEQIGLWSGFAA
AGGRPLPAAIHMDSGMNRLGLDETAVELLAADNRRLDGIQPVLVMSHMACADERDHAMNR
QQLDRFTVLADRLGVSAPRSLAASSTIFLGADYHFDLIRPGAGLYGINPMPDSPNPLRQT
VRLHGKILQVRDVDTPQTVGYGASHRFKSKGRVATIACGYADGLFRSLGNRGFGVIGGVK
VPVVGRISMDLITLDVSAVAPAHVHAGALVELIGPDHDVDALAAEAGTIGYEILTSLGRR
YLRDYSGGNT
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
ttgatgaccgcccacgaccgtgccaccggcattctgtccatcgatctcgacgccatcgcc
gacaactggcgcaccctggcggcgcacgcccccaatgccgaggccgccggggtggtcaag
gccgatggttatggtctgggcgcggcaccggtggcgcgggccttgcgcaaggccgggtgc
accaccttcttcgtcgccaccatcgacgaaggcatcagcctgcgcccgcatgtgaacgac
gcccgcatcctggtgctgggcggggtgttaccgggcaccggcgccgatttcatcggccat
caactgatcccggtactcaacagcccggaacagatcggcctgtggtcgggcttcgccgcc
gccggcggtcgccccctgcccgccgccatccacatggacagcggcatgaaccgcctgggc
ctggacgaaacggcggtggagctgctggccgccgataaccgccgcctggacggcatccag
cccgttctggtcatgagccacatggcctgcgccgacgaacgcgaccacgccatgaaccgt
cagcaactggaccgcttcaccgtgttggccgaccggttgggggtaagcgcgccgcgatcg
ctggcggccagttccaccattttcctgggtgcggattatcatttcgacctgatccgtcca
ggagcagggctttacggcatcaaccccatgccggacagccccaatccgttgcgtcagacc
gtccgtttgcacggaaaaatcctgcaagtccgcgacgttgacaccccccagaccgttggc
tatggtgccagccatcggttcaaatccaagggccgggtcgccaccatcgcctgcggttac
gccgatggcttgttccggtccttgggcaatcgcggctttggtgtcatcgggggggtaaaa
gtgccggtcgtaggccgcatttccatggatttgatcaccctcgacgtcagcgccgtggcg
cctgcgcacgtgcatgccggcgccctggtggaactgatcggccccgaccacgacgtcgac
gccctggccgccgaggccggcaccatcggctatgaaatcctgacaagtctgggcaggcgt
tacctgcgcgactacagcggaggaaatacctga

DBGET integrated database retrieval system