KEGG   Mycobacterium haemophilum: B586_03590Help
Entry
B586_03590        CDS       T04111                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
mhad  Mycobacterium haemophilum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(3965777..3966817)
Genome map
AA seq 346 aa AA seqDB search
MAAAAEELDVDGISVRLTNPDKVLFPRLGPNGTKRRLVEYYLAVAGGPMLTALRDRPTHL
QRFPDGIDGEEIYQKRVPQHHPDYLQTCRVTFPSGRTADALKVTHSAAIVWAAQMGTITL
HPWQVRCPDTEHPDELRIDLDPQPGTGFEQARAVAVDVLRPVLDDLGLVGYPKTSGGRGI
HVFLRIATDWDFIEVRRAGIALAREVERRAPDAVTTEWWKEKRGMRVFLDFNQNARDRTM
ASPYSVRRTQIATVSTPLTWDELAVADPDDYTMATVPDLVHGRDDPWAGIDDVDQSIVPL
LEMAAADAERGLGDMPYPPNYPKMPGEPKRVQPSRDINRKSGTKPT
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgcagcggaagaacttgacgtcgacggcatttcggtgcggttgaccaacccc
gacaaggtgcttttccccaggcttgggcccaacgggacgaagcggcggcttgtggagtac
taccttgccgtggcaggcggcccgatgctgaccgcgctgcgcgatcggcccactcacctg
cagcgtttcccggacggcatcgacggggaggagatttaccagaagcgggtgccgcagcat
caccccgactatcttcagacctgtcgggtgacgttcccgtcggggcgaaccgctgacgcg
ctgaaggtgactcattccgccgccattgtgtgggcggcgcagatgggcacgatcacgctg
cacccgtggcaggtgcgctgccccgacaccgagcatcccgacgaactgcgcatcgacttg
gacccgcagcccggcaccggcttcgagcaggcgcgcgcggtcgctgtcgatgtgctgcgg
ccggtgctcgacgaccttggtctggtcgggtaccccaagacatccgggggccgcgggatc
cacgtgttcctgcggatcgccaccgactgggacttcatcgaggtgcgccgggcgggcatc
gcgctagcccgcgaggtggagcgtcgcgcacccgacgcggtgaccacggagtggtggaag
gaaaaacggggcatgcgggtttttctggacttcaaccagaacgcccgagaccgcaccatg
gcgtcgccgtattcggtgcggcgcacccagatcgcgaccgtatcgaccccgctgacctgg
gacgaactggccgtagccgacccggacgactacaccatggcgaccgtgcctgatctggtg
catggccgggacgacccgtgggccggcatagatgatgttgatcagtcgattgtcccgctg
ttggagatggccgcggccgacgcagagcgcggactgggggacatgccgtatccgccgaac
tacccaaaaatgccgggcgagcccaaacgggtgcagccgagccgggacattaatcgaaaa
tcggggaccaaaccgacttga

DBGET integrated database retrieval system