KEGG   Marinobacter hydrocarbonoclasticus ATCC 49840: MARHY0994Help
Entry
MARHY0994         CDS       T02083                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase,carbon dioxide fixation
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mhc  Marinobacter hydrocarbonoclasticus ATCC 49840
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mhc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MARHY0994 (ppc)
  Energy metabolism
   00680 Methane metabolism
    MARHY0994 (ppc)
Enzymes [BR:mhc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MARHY0994 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1036336..1038981
Genome map
AA seq 881 aa AA seqDB search
MTELHSDLRENVRLLGDLLGQSILRFPGQDCYDRIEEIRAAAKADRRQESGSGQRLVKLL
GQLSDDELLPVTRAFNQFLNLANLAEQYHGIRRKQGHPSDLMVESLGDVFDRLKSGGIDP
QELHRKVADLRIEFVLTAHPTEVARRTLILKYDEMSDCLSRLDHDDLMPGEREEIVDRLS
LLIAEAWHTDEIRHERPTAVDEAKWGFAVIENSLWQALPKFLRSLDTSLSEATGQGLPLQ
VSPIRIASWMGGDRDGNPNVTHEVTREVFLLGRWMAADLYLRDIQALRAELSMWQASDEL
RAEVGDSREPYRQVLAQLRERLIKTRDWAEASVKGEPADDSGILFENEDLTGPLELCYRS
LMECGLETIANGPLLDTIRRAHTFGLPLIRLDIRQEASRHAEAVAEMVNYLGLGDYLSWS
EQERQAFLVKELKGRRPLVPRNWQPSEPVREVLATCEVVAGQTPEALGSYVISMASKPSD
VLNVILLLREAGMAFPMRVVPLFETLDDLKGAPDSMAALYEVDWYREYCSGRQEVMIGYS
DSSKDAGQLMAAWAQYQAQEKLTEVANRYGVHLTLFHGRGGTVGRGGGPANRAILSQPPG
SVNGSFRITEQGEMIRFKFGLPRLAVQSLTLYTTAVIEATLAPPPVPKDEWREVMDWLTE
RSLRSYREVVRENPDFVPYFRQVTPETALGKLALGSRPARRKATGGVESLRAIPWIFAWT
QMRLMLPSWLGSDVALEQAAQADRLPELREMMQGWPFFRTYVDMLEMVLAKADLRIASYY
EQTLVEDEHLLALGQSLRQRLQGCIERLLELKQQQTLLEQEPVFAHSMKVRNPYTDPLHY
LQAELLRRDRESEGAGKVPELVERALKVTMAGISAGMRNTG
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaactgcactcggatcttcgagaaaacgtacgtttgctgggcgatctgcttggc
cagagcatactccgattccccggacaggactgctacgaccgcattgaagaaatccgcgcc
gccgccaaggctgaccggcgccaggaaagtggttccggacaacgcctggtgaaactcctg
ggccagctcagcgatgatgagctgctgccggtgacccgagcctttaaccagttccttaat
cttgccaacctggctgagcagtaccatggaattcgtcgcaagcaggggcatccgtcagat
ctgatggtggaatccctgggggacgtgtttgatcggctgaagtccggggggatagacccg
caagagttgcatcggaaggttgcagatttacgcatagagtttgtgctcaccgcgcacccc
accgaagtggcccggcgtacattgatcctcaagtacgatgaaatgtccgattgcctgtcg
aggctggatcatgacgacctgatgcccggtgaacgggaggaaattgttgaccggttgtcg
ctgttgattgccgaggcctggcataccgacgagattcggcatgaaaggccgaccgccgtg
gacgaggccaagtggggcttcgccgttatcgagaacagtctctggcaggcgctgccgaaa
tttctccgtagcctggacacctcgctgtcggaggcgaccggtcaggggcttccgttgcag
gtgtcgccgatccgaattgcctcgtggatggggggagaccgtgatggcaaccccaatgtc
acccacgaagtgacccgggaagtgtttctgcttggtcgctggatggccgcagatctctat
ctgcgcgatatccaggcgctgagagcggagctctccatgtggcaggcaagcgatgaattg
cgggccgaggtgggagattcccgggagccgtatcgccaggtgctggcccagttgagggaa
cgcctgatcaagacccgggactgggccgaggccagcgtcaagggcgagccggcggacgat
tcgggcattctgtttgagaacgaggatctgaccgggcctttggaattgtgctatcgctcc
ctgatggagtgcgggctggagaccattgccaatggtccgctgctggataccattcgccgg
gctcacaccttcggcctgccactgatccgactggatatccgccaggaggcctcacgccac
gccgaggcggtggcagagatggtgaactacctggggttgggtgactatctgtcctggtcg
gaacaggagcgccaggcgtttctggtcaaggaactgaaagggcggcgccccctggtgccc
cggaattggcaaccctccgagccggtgcgggaggtgctggcaacctgcgaggtggtcgca
ggccagacaccggaagccctgggttcctacgtcatttccatggccagcaagccctcggac
gttttaaacgtgattttgctgctgcgggaagcggggatggctttccccatgcgcgttgtg
ccgctgttcgaaacgttggatgatctcaagggggcacccgacagtatggcggccctgtac
gaggtggactggtatcgggaatactgcagcggacgccaggaagtcatgatcggctattca
gactcctccaaagatgccggccagttgatggcggcctgggcccagtaccaggcccaggag
aagctgaccgaagtggccaatcgatatggagtgcatctgactctgtttcatggccgcggc
ggcaccgtgggccggggcggtggtccggcgaatcgggcgattctgtcccagccgccgggc
tcggtgaacggcagcttccggattaccgagcagggcgagatgatccgctttaaatttggt
ctgccgaggctggcggtgcagagtctgaccttgtacaccaccgcggtgattgaggcgacc
ctggcgccaccacctgtgccaaaggatgagtggcgcgaggtgatggactggctgaccgag
cgttcgctgcggtcctaccgtgaggtggtccgtgagaatccggattttgtgccttacttc
cgccaggtcacaccggaaacggctctgggtaaacttgcccttggcagccggccggcccgg
cgcaaggccacagggggcgttgaaagcctgagagccattccgtggatttttgcctggacc
cagatgcggttgatgctgccaagctggctgggcagtgatgttgccctcgaacaggcggcc
caggcggaccgcctgcccgaactgcgggagatgatgcagggctggccgttcttccgcacc
tacgtggatatgctggaaatggtcctcgccaaggcagatttgcgtattgccagctattac
gagcagaccctggttgaggacgagcacttgctggcgcttggccagagcctgaggcagcgt
ttgcagggctgcattgagcgtctgctggagcttaaacagcaacagactctgctggagcag
gagccggtgtttgcccattcaatgaaagtccggaatccctacactgatccgctgcactat
ctgcaggcagaattactcaggcgtgaccgggaaagcgagggggctggaaaggtgccggaa
ttggtcgagagggcgctgaaggtgaccatggccggaatttctgccggtatgcgaaatacc
ggttaa

DBGET integrated database retrieval system