KEGG   Mannheimia haemolytica USDA-ARS-USMARC-183: D650_15380Help
Entry
D650_15380        CDS       T02523                                 

Definition
(GenBank) sialidase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
mhq  Mannheimia haemolytica USDA-ARS-USMARC-183
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:mhq00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    D650_15380
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    D650_15380
Enzymes [BR:mhq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     D650_15380
Bacterial toxins [BR:mhq02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   D650_15380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1478581..1480968
Genome map
AA seq 795 aa AA seqDB search
MEKMMRKINQLIISPYFFLSILSASANSDFWKSDLNFNLTNITKRVGVDNFTTPVAGEPW
AGIGPNGEAAGTAPLYYSRIPAMQVTEDNKLVVMFDLRWNRAYDQDRIDPGIAISSDGGH
TWTKKTAWSFDRTNHPARRSMDPTLLHNPIDNSLYVMHGTWSMSDQQWYGGRVPHFNSGS
WAATIYKSTDGGLNWEKNTEFSKFSNLDVFSKVTKNGKPTLGFLGGVGSGIVMQDGTLVF
PIQTAHQNGIATTIMYSKDNGKTWEMPEIDNPVAPNQSSLENMVFELEPGKLVMTGRGNS
RWAYSSTDMGKTWELFTPTNGLLPTSSQPTQGSSIYVTLPNGRKVLLISKPDGKNDGWKR
GDITLWMLDAKDPSHKHKVHIIRPGSGNAAGAGYSSLAYKEGNLFVAFENDGDISVKNLT
EHIAEMEAKAIEWGLPDELTPALDKINALPYLNKAQKETLVEKMRRANDTAIAQSFVINK
EMYNLKNNSDELDKLAKNITKALPSQQNIYQRALAYVNKVTNTADTTYLNYNGIMDTYAN
LYESYLALNTKLDFTRYIQKARKFNEYNTDILYRSFDNFFAHYDTGVKHNNLSLGLNTKL
SENLRGGLFFEYSNKNRNSVQIGARAKYEMDNHQLSGFLRYRGVKHKDMLARNNSVDGYL
NYAYRIQLDDKLSISPSVGAYVSRSSRSLIDEDLAINSRTVYASDVGLNIHYKLNDIDAY
IRPSIGFVNGDITLSQSNDMTNTYKIKDKSNVYSVTTGLKKRFANGVALGADFKLHRYGS
QTTESNFGLNVSYNW
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaatgatgagaaaaatcaatcagttaatcatatccccatactttttcctaagt
attttatctgcttccgctaactctgatttttggaaaagcgaccttaattttaatctcaca
aatattaccaagcgtgtcggagtcgataactttaccactccagtagctggcgagccttgg
gctggtattggtccaaatggtgaagctgcaggtactgcgccattatattatagccgtatt
ccagctatgcaagttaccgaagataacaaattagttgttatgtttgatttacgctggaat
cgtgcgtatgaccaagatcgtattgatcctggtattgcgatttcttccgatggtggccat
acttggacgaagaaaaccgcttggtcttttgatagaactaatcacccagcacgccgttca
atggatccaacgctattacataatcctattgataatagtttatatgtaatgcacggaact
tggtctatgtcggatcaacaatggtatggtgggcgtgttcctcactttaatagtggcagc
tgggcagctaccatttataaatctactgatggtggtttaaattgggagaaaaatactgag
tttagtaaattcagcaatttagacgtattttctaaagtcaccaaaaatggaaaacctacc
ttaggctttttaggcggggtcggatctggaattgtaatgcaagatggtacgttggttttc
ccaattcaaaccgcacatcaaaatggtattgcgaccactattatgtattctaaggataat
gggaaaacttgggaaatgccagaaattgacaacccagttgcaccgaaccaaagttcttta
gaaaatatggtgtttgaactcgaaccgggtaagctagtgatgactggacgaggaaacagt
cgctgggcatactcttctactgatatgggtaagacctgggaattatttactccaactaat
ggattattaccaactagctcacaaccaactcaaggctcttctatctatgtaacactacca
aatggtcgaaaagtgctactaatctctaaaccagatggaaagaatgatgggtggaaaagg
ggtgatattacactttggatgctagatgcaaaagatccatcgcacaaacacaaggtgcat
attattcgtccaggttcaggtaatgccgctggtgctggttattcctctttagcctataaa
gaagggaatttatttgttgcttttgaaaacgatggtgatatttcagtaaaaaatttaact
gaacatattgctgaaatggaagcaaaagctatcgaatggggattaccagatgaacttact
cctgctttggataaaatcaatgcactgccttatctcaataaagctcaaaaagagacgcta
gtcgaaaaaatgcgtcgtgctaatgatactgcgattgcacaatcttttgtgattaacaaa
gaaatgtataatctgaaaaacaatagtgatgagctggataaattggcaaaaaatattact
aaagcactgccgtctcaacagaatatttatcaaagagccttagcctatgtgaataaagtc
accaatacagcggataccacttatttaaattataatggtattatggatacctatgctaat
ttatatgaaagctatttggctttaaatactaaattagacttcactcgctacatccaaaaa
gcgagaaagttcaatgaatataacactgatattttatatcgtagctttgataatttcttt
gcccattacgacacaggtgtaaaacacaataatctatccttaggcttgaatacaaaatta
agtgagaatttacgtggtggcttattctttgaatacagtaataaaaatcgtaatagcgta
caaattggtgcaagagctaaatatgaaatggataatcaccaactttctggcttcttacgc
tatcgtggcgtaaaacataaagatatgctagcacgtaataacagtgttgatggctaccta
aattatgcttatcgtattcaattagatgataaattaagcattagcccatcagttggtgct
tacgtttcacgttcttctcgctcattaatagatgaagatcttgcgattaatagccgcacg
gtctatgcaagtgatgtaggattgaatatccattataagctaaatgatattgatgcttat
attcgtccaagtataggctttgtcaatggtgatataactttatctcaatctaatgatatg
acaaacacatacaaaataaaggataaaagtaacgtgtattctgtcacgacagggttgaaa
aaacgctttgcaaatggtgtggcattaggggctgatttcaaattacatcgttatggttct
caaactactgaaagtaatttcggtctaaatgtaagttataactggtaa

DBGET integrated database retrieval system