KEGG   Methanospirillum hungatei: Mhun_0174Help
Entry
Mhun_0174         CDS       T00325                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mhu  Methanospirillum hungatei
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mhu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mhun_0174
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mhun_0174
   00680 Methane metabolism
    Mhun_0174
Enzymes [BR:mhu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Mhun_0174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
192783..194261
Genome map
AA seq 492 aa AA seqDB search
MNEQYGKPLKIPRTMSTQHPDNVHTPFFTENIELTGEDEVKEAYYVYSHLGCTEQMWDCE
GKEVDNYVVKKLLSRYGDYFKEHHLGRDLFLTLRVPNPEIERTEAKILLETLGSIPRSYD
VAHHFYNDTYAPIFEIILPMTTSFASIDNIYQYYCDFVIGQQYKRLGGRDLTIAEWIGPF
HPDKIRVIPLFEDKDGMLAADTILRRYFQDKDLDYQRVFLARSDPAVNYGQIGAVLLNKI
ALWRLHLLSEDTGIPVYPIIGAGSAPFRGNLRPDTVRRVTDEYAGAYTFTIQSAFKYDTN
LEEAVSAIRYLEEREITPAREIDDTYAISLIERYAAGYQKQIRSLAPLINRVAAYIPSRR
KRKLHVGLFGYSRNMGGVSLPRAITVTAALYSIGIPPEVLGLSALTENDREFVLENYRYV
TEDLSDACRYLNPDSSFLPDEIKKILPDWIEIDPHSEHRVLSGQIEKAVTACQIDSVQDM
IIRAGAIRKFLG
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagcagtatggaaaacctttgaaaataccccgaacgatgagtacccagcacccg
gataatgtccatactccgtttttcactgagaatattgagctcaccggtgaagatgaggta
aaggaagcgtattacgtgtattcacacctgggatgcactgagcagatgtgggactgtgaa
gggaaagaagttgataattacgttgtgaagaaactactttcccggtatggcgattatttt
aaagagcatcatctgggccgtgatctcttcctcacgcttcgggtaccaaacccggagata
gaacggacagaagcgaagatcctactggaaacactggggtcaattccccggtcctatgat
gttgcacatcatttctataacgacacctatgccccgatctttgagattatcctcccgatg
acaacttcatttgcatcaattgacaacatctaccagtactattgtgactttgtcatcggt
cagcaatataaacggttaggtggccgtgatcttacgattgcagagtggattgggccgttc
catccagacaagatccgtgtcattccgctctttgaggataaggatggtatgcttgccgct
gatacgatcctccggcggtattttcaggataaggatcttgattaccagcgggtgttcctt
gcacgatctgatccggcggtgaattatggacagattggggcagtactcctgaataaaatt
gccctctggcgtcttcaccttctgtcggaagataccgggattcccgtctatccgatcatc
ggggcaggatcagccccttttagagggaatttacggccggataccgttcgaagggtgact
gatgagtatgctggggcgtatacctttactatccagtcggcatttaagtacgataccaat
ctggaagaagcggtgtctgcaatccggtatcttgaggaacgggagatcactcctgcacgg
gagattgatgatacgtatgcgatatcactcatcgagcgatatgctgccgggtatcagaaa
cagatacggtcattggctcctcttattaatcgtgtggcggcatatattccaagccgacgg
aaacgaaagctccatgtgggcttattcgggtattcccggaacatgggtggtgtttcactt
ccccgtgcgattaccgtgaccgctgcattgtattcaatcgggatacctccggaggtcctg
ggattatctgcactgactgagaacgatcgggagtttgtccttgagaattaccggtatgtg
actgaagatctcagtgatgcatgccgatatctcaatcctgactcttcatttctgccggat
gagatcaagaagatcctccctgactggattgagattgatccccattctgagcatagagtc
ctctctggtcagatagagaaggccgtgactgcctgtcagatagatagtgtacaggatatg
atcatcagggctggagcaatccgaaagtttctcgggtaa

DBGET integrated database retrieval system