KEGG   Mannheimia haemolytica M42548: MHH_c01580Help
Entry
MHH_c01580        CDS       T02635                                 

Gene name
tufB
Definition
(GenBank) elongation factor TufB
  KO
K02358  
elongation factor Tu
Organism
mhx  Mannheimia haemolytica M42548
Brite
Translation factors [BR:mhx03012]
 Eukaryotic Type
  Elongation factors
   MHH_c01580 (tufB)
 Prokaryotic Type
   MHH_c01580 (tufB)
Mitochondrial biogenesis [BR:mhx03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    MHH_c01580 (tufB)
Exosome [BR:mhx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   MHH_c01580 (tufB)
  Exosomal proteins of breast cancer cells
   MHH_c01580 (tufB)
  Exosomal proteins of colorectal cancer cells
   MHH_c01580 (tufB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(136411..137595)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKHFGGAARAFDQIDNAPEEKARG
ITINTSHVEYDTATRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALQALN
GVAEWEEKILELANHLDTYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIRTG
DEVEIVGIKDTAKTTVTGVEMFRKLLDEGRAGENVGALLRGTKREEIERGQVLAKPGSIT
PHTDFESEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMT
VSLIHPIAMDEGLRFAIREGGRTVGAGVVAKIIK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaaagaaaaatttgaacgtacaaaaccgcacgttaatgtgggtacaatcggccac
gttgaccatggtaaaacaactttaacagcagcaatcactaccgtattagcaaaacacttc
ggtggtgcagctcgtgcatttgaccaaatcgataacgcgccagaagaaaaagcgcgtggt
atcaccatcaacacttcacacgttgagtacgatacagcaactcgtcactacgcacacgtt
gactgcccgggacacgcggactatgttaaaaacatgattaccggtgcggcacaaatggac
ggcgctatcttagtagtagcagcaactgacggtccaatgccacaaactcgtgagcacatc
ttattaggtcgccaagtaggtgtaccatacatcatcgtattcttaaacaaatgcgacatg
gtagatgacgaagagttattagaattagttgagatggaagtgcgtgaacttctttcacaa
tacgacttcccaggtgatgacactccaatcgtacgtggttcagcgttacaagcgttaaac
ggcgtagcagagtgggaagagaaaatccttgaattagcaaaccacttagacacatacatt
ccagagcctgagcgtgcgattgataaaccattcttattaccaatcgaagacgtattctca
atttcaggtcgtggtacagtagtaacaggtcgtgttgagcgtggtatcatccgcactggt
gatgaagttgaaatcgtaggtatcaaagatacagcgaaaacaaccgtaacaggtgttgag
atgttccgtaaattattagacgaaggtcgtgcgggtgagaacgtaggtgcattattacgt
ggtactaaacgtgaagaaatcgaacgtggtcaagtattagcgaaaccgggttcaatcact
ccacacacagacttcgaatcagaagtttacgtattatcaaaagaagaaggtggtcgtcac
actccattcttcaaaggttaccgtccacagttctacttccgtacaacggacgtaacaggt
acaatcgaattaccggaaggtgtagagatggtaatgccgggcgacaacatcaaaatgact
gttagcctaattcacccaatcgcgatggacgaaggtttacgttttgcgattcgtgaaggt
ggtcgtacagtaggtgcgggcgttgtagctaaaatcatcaaataa

DBGET integrated database retrieval system