KEGG   Mycobacterium intracellulare ATCC 13950: OCU_41350Help
Entry
OCU_41350         CDS       T02158                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase 2
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
mia00564  Glycerophospholipid metabolism
mia01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mia00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    OCU_41350
Enzymes [BR:mia01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     OCU_41350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 FAD_binding_3 Pyr_redox_2 GIDA NAD_binding_8 3HCDH_N Pyr_redox HI0933_like Thi4 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AFC45354
UniProt: H8IP51
LinkDB All DBs
Position
complement(4362764..4364470)
Genome map
AA seq 568 aa AA seqDB search
MLGPEQRQAAWDRLGAEQFDVVVIGGGVVGSGCALDAATRGLKVALVEARDFASGTSSRS
SKMFHGGLRYLEQLEFGLVREALYERELSLTTLAPHLVKPMPFLFPLTNRVWERPYIAAG
IFLYDRMGGAKSVPAQKHLTRAGALRLSPGLKRSSLIGGIRYYDTVVDDARHTMTVARTA
AHYGAVVRTSTQVVALLREGDRVTGVRVRDSEDGAVTEVRGHVVVNATGVWTDEIQALSK
QRGRFQVRASKGVHIVVPRDRIVSDVAIILRTEKSVMFVIPWGSHWIIGTTDTDWNLDLA
HPAATKADIDYILTTVNTVLAIPLTHADIDGVYAGLRPLLAGESEETSKLSREHAVAVPA
PGLVAIAGGKYTTYRVMAADAIDAAAQFIPARVAPSITEKVSLLGADGYFALINQAEHVA
ELQGLHPYRVRHLLDRYGSLIGDVLALADDRPDLLDPIKEAPGYLRVEALYAVTAEGALH
LEDVLARRMRISIEYSHRGVDCAREVADVVAPVLNWSAADIDREVANYTARVEAEVLSQA
QPDDVSADELRASAPEARAEILEPVPLK
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
gtgctgggtccggaacagcggcaggcggcctgggaccggctgggcgccgagcagttcgac
gtggtcgtgatcggcggcggcgtggtgggttcgggctgcgcgctggacgccgcgacccgc
gggctcaaggtggcgctggtggaagcgcgcgacttcgcctcgggcacctcgagccgctca
tcgaagatgttccacggcggcctgcgctacctcgagcaactggagttcggcctggtccgc
gaggcgctctacgagcgcgagctgtcgctgaccacgctggcgccgcacctggtcaagccg
atgccgttcctgttcccgctgaccaaccgcgtgtgggaacggccctacatcgcagccggc
atctttctctacgaccggatgggcggcgcgaaatccgttccggcacaaaagcatttgacc
cgtgcgggcgcgttgcggttgagcccgggcctcaagcgcagctcgttgatcggcggaatc
cgttactacgacacggtcgtcgacgacgcccggcacacgatgaccgtcgcgcgcaccgca
gcgcattacggcgcggtggtgcgtacctccacccaggtcgttgccctgctgcgcgagggc
gatcgggtgaccggggtgcgggtccgcgattccgaggacggcgcggtcaccgaagtccgc
ggccacgtggtggtcaacgcgaccggggtgtggaccgacgagatccaggcattgtccaag
cagcgcgggcgatttcaggtgcgggcctccaagggcgtgcacatcgtggtgccgcgcgac
cgcatcgtcagcgacgtcgcgatcatcctgcgcaccgagaagtcggtgatgttcgtcatc
ccgtggggcagccactggatcatcggcaccaccgacaccgactggaatctcgacctggcc
catcccgcggccaccaaggccgacatcgattacatcctcaccacggtcaacacggtgctg
gccatcccgctgacccacgccgacatcgacggggtgtacgccgggctgcggccgctgctg
gccggggagagcgaggaaacctcgaagctgtcccgcgagcacgccgtggcggtgcccgcg
ccgggattggtggccatcgcgggcggcaagtacaccacctaccgggtgatggccgcggat
gcgattgacgctgcggcccaattcattccggcgcgggtggcgccgtcgatcaccgagaag
gtcagcctgctgggcgccgacggttacttcgcgctcatcaaccaggccgagcacgtcgcc
gagctgcaggggctgcacccctaccgggtgcgccacctgctggaccgctacggctcgctg
atcggcgacgtgctggcgctggcggacgaccgccccgacctgctcgacccgatcaaggag
gcgccgggctacctgcgggtcgaggcgctctatgccgtgaccgccgagggggccttgcat
ctggaggacgtcctggcccgccggatgcgcatctccatcgaatactcacaccgcggtgtc
gactgcgcccgcgaggtcgcggatgtggttgcgccggtgctgaattggtccgcggcggac
atcgaccgcgaggtcgccaactacaccgcccgggtggaggccgaggtgctgtcccaggcc
cagcccgacgacgtgtcggccgacgaattgcgggccagcgcgcccgaggcccgcgccgag
atcctcgagccggtcccgctcaagtga

DBGET integrated database retrieval system