KEGG   Mycobacterium intracellulare ATCC 13950: OCU_42380Help
Entry
OCU_42380         CDS       T02158                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
mia00250  Alanine, aspartate and glutamate metabolism
mia00410  beta-Alanine metabolism
mia00430  Taurine and hypotaurine metabolism
mia00650  Butanoate metabolism
mia01100  Metabolic pathways
mia01110  Biosynthesis of secondary metabolites
mia01120  Microbial metabolism in diverse environments
mia02024  Quorum sensing
Module
mia_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mia00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    OCU_42380
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    OCU_42380
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    OCU_42380
   00430 Taurine and hypotaurine metabolism
    OCU_42380
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    OCU_42380
Enzymes [BR:mia01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     OCU_42380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AFC45457
UniProt: H8IQQ1
LinkDB All DBs
Position
complement(4470280..4471662)
Genome map
AA seq 460 aa AA seqDB search
MPQHPSLPAHSIAPAYTGRLFTAPVPALRMPDESMDPDAAYRFIHDELMLDGSSRLNLAT
FVTTWMDPEAGKLMAETFDKNMIDKDEYPATAAIEQRCVCMVADLFHADGLNDADPYSAC
GVSTIGSSEAVMLGGLAMKWRWRAKIGKDWKGRTPNLVMGSNVQVVWEKFCRYFDVEPRY
LPMEEGRYVITPEQVVDAVDENTIGVVAILGTTYTGELEPVADICGALDKLAAGGGVDVP
VHVDAASGGFVVPFLHPELKWDFRLPRVVSINVSGHKYGLTYPGVGFVVWRSKEYLPDDL
VFRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGREGYTKVMQALSGTARWLGEQLRV
SEHCELVSDGSAIPVVAFRLSKDRGYTEFDVSHELRTYGWQVPAYTMPDNATNVSVLRIV
VREGLSADLARALHDDAVSALSSLDKLRPGGHYADQHFAH
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
gtgccacaacacccttcgctgcccgcgcactccatcgcccccgcctacacgggccggctg
ttcaccgcgccggtccccgcactgcggatgcccgacgaatcgatggatcccgacgccgcc
taccgcttcatccacgacgagctgatgctcgacgggagctcgcggctgaacctggccacc
ttcgtcaccacctggatggaccccgaggccggcaagctgatggccgagacgttcgacaag
aacatgatcgacaaggacgagtacccggcgaccgcggccatcgagcagcgctgcgtgtgc
atggtggccgacctgttccacgccgacggcctgaacgacgccgacccctacagcgcgtgc
ggggtgtccacgatcggctccagcgaggcggtgatgctcggcgggctggcgatgaagtgg
cggtggcgcgcgaaaatcggcaaggactggaagggccgcaccccgaacctggtgatgggg
tccaacgtccaggtggtctgggagaagttctgccgctacttcgacgtcgagccccgctac
ctgccgatggaggagggccgctacgtcatcacccccgaacaggtcgtcgacgccgtcgac
gagaacaccatcggcgtggtggcgatcctgggcaccacctacaccggcgagctggagccg
gtcgccgacatctgcggcgcgctggacaagctggccgccggcggcggtgtggacgtcccg
gtgcacgtcgacgccgccagcggcgggttcgtggtgcccttcctgcaccccgagctcaag
tgggacttccggctgccccgggtggtgtcgatcaacgtcagcggccacaagtacgggctg
acctatcccggcgtcgggttcgtggtgtggcgcagcaaggagtacctgcccgacgacctg
gtgttccgggtcaactatctcggcggcgacatgccgaccttcacgctgaacttctcccgg
cccggtaaccaggtggtcggccagtactacaacttcctgcggctcggccgggagggctac
accaaggtcatgcaggcgctgtccgggacggcgcgctggctcggtgagcagctgcgggtc
agcgagcactgcgagctggtctccgacggctcggcgatccccgtggtcgcgttccggctg
tccaaggaccgcggctacaccgagttcgacgtctcccacgagcttcggacctacggctgg
caggtgcccgcctacaccatgccggacaacgccaccaacgtctccgtgctgcgcatcgtg
gtgcgcgagggcctgtccgccgacctggcccgggccctgcacgatgacgccgtctcggcg
ctcagttcgctggacaagctccggcccggcggccactacgcggatcagcacttcgcgcac
tga

DBGET integrated database retrieval system