KEGG   Microcoleus sp. PCC 7113: Mic7113_2338Help
Entry
Mic7113_2338      CDS       T02374                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:mic00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Mic7113_2338
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Mic7113_2338
Enzymes [BR:mic01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Mic7113_2338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2676989..2677333
Genome map
AA seq 114 aa AA seqDB search
MQTLPKERRFETLSYLPPLTDSQIVKQVQYILDQGYIPAVEFSDNSEPEHHYWTLWKLPL
FKARSTQEVMAEVDACRSDYRDSYIRVVGFDNVKQCQVLSFIIHKPNTNARGRF
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactttaccgaaagagcgtcgttttgaaaccctttcctacttgcccccgctgact
gattctcaaattgtcaagcaagttcaatacattttggatcaagggtatatccccgctgta
gaattcagcgacaattcagaaccagagcatcactactggacattgtggaagttacccctt
ttcaaagctcgcagcactcaagaagtgatggctgaagtggatgcttgccgttctgactat
cgcgactcttacatccgtgtggtgggttttgataatgtgaagcagtgccaagtgctgagc
ttcatcattcacaagcccaataccaatgctcgtggtcgcttctaa

DBGET integrated database retrieval system