KEGG   Microcoleus sp. PCC 7113: Mic7113_3187Help
Entry
Mic7113_3187      CDS       T02374                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
mic00010  Glycolysis / Gluconeogenesis
mic00020  Citrate cycle (TCA cycle)
mic00620  Pyruvate metabolism
mic01100  Metabolic pathways
mic01110  Biosynthesis of secondary metabolites
mic01120  Microbial metabolism in diverse environments
mic01130  Biosynthesis of antibiotics
mic01200  Carbon metabolism
Module
mic_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mic00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mic7113_3187
   00020 Citrate cycle (TCA cycle)
    Mic7113_3187
   00620 Pyruvate metabolism
    Mic7113_3187
Enzymes [BR:mic01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Mic7113_3187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase MadL PASTA
Motif
Other DBs
NCBI-ProteinID: AFZ18927
UniProt: K9WHB7
LinkDB All DBs
Position
complement(3657277..3658590)
Genome map
AA seq 437 aa AA seqDB search
MIHEVFMPALSSTMTEGKIVSWVKSPGDRVEKGETVVVVESDKADMDVESFYEGYLAVIT
VPAGESAPVGAAIALLAESEAEIEQVKQQAAQSSQGTAVSTPQKDSVPTPTPGQVEAAPV
AAQDTPSPRNGRIVASPRARKLAKELRVDLNSLKGSGPYGRVIAEDVEAAAGKGSTPAAT
PAATTTAPKPTSTPAPTTPAPRPAPTPAVPVAALGETVPFNTLQNAVVRNMVASLQVPTF
HVGYTITTDELDKLYKKIKTKGVTMTALLAKAVAVTLQKHPLVNASCVEQGIQYHSSINI
AVAVAMPGGGLITPVLQQADQVDIYSLSRNWKDLVERARLKQLQPEEYSSGTFTLSNLGM
FGVDRFDAILPPGQGSILAIGASRPSVVATEEGMMGVRRQMQVNITCDHRIIYGADAAAF
LQDLAKLIETDPQSLTL
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgatccacgaagttttcatgcccgccctcagttccacaatgaccgaaggcaaaatagtc
tcttgggtaaaatctccaggggaccgagttgagaaaggcgaaacggtggtggtggttgag
tcagataaggcagatatggacgttgagtccttctatgaaggttatctggctgtgatcacg
gtaccggctggtgaatcagctcccgtaggggcggcgatcgcacttttggcagaatcggaa
gctgaaattgagcaagttaaacaacaagcggctcaatccagccagggtactgctgtttcc
acccctcaaaaagactcggtacccacaccgacgcctggacaagtagaggctgccccagtg
gcggctcaagatacacccagccctcgcaatggacggattgtcgcctcacctcgcgctcgc
aagttagccaaggaactccgcgtcgatctcaacagcctcaaaggcagtggcccctatggg
cgggttattgccgaggatgtggaagccgccgccgggaaagggagtactcctgccgctacg
cctgccgcgacgacaacagcaccgaaaccaacctcaacccccgcgccaactacccctgca
cctcgtccagcccccaccccagcggttcctgttgctgccttgggtgaaaccgtaccgttt
aatacgctgcaaaatgcggtggtacggaatatggttgccagccttcaggtgcctaccttc
cacgttggctataccattacaaccgatgagctggataagttatacaaaaaaatcaagacc
aaaggcgtgacgatgacggcactgctggctaaggccgtggcggttacgttacaaaaacat
cctttggtcaatgccagttgtgtagaacagggcattcagtatcacagttccatcaatatt
gccgtcgcggtggcaatgcctggtggaggactgattacgccggtcttacaacaagctgac
caagttgatatttattccctatctcgcaattggaaagacttggtagaacgtgccagactc
aagcagttgcagccggaggaatatagctctggtaccttcacgctgtccaatttgggcatg
tttggggttgaccgttttgatgctattttaccgccaggacaagggtcaattttggcgatc
ggggcatcacgtcctagcgttgtggcaacggaggagggaatgatgggtgtgcggcgtcag
atgcaggtgaatatcacttgtgaccaccggattatttacggtgctgatgcggcagcgttc
ctgcaagacttggcgaagttgattgaaaccgatccgcaatcgttaacgctttag

DBGET integrated database retrieval system