KEGG   Mycobacterium intracellulare subsp. intracellulare: MIP_06405Help
Entry
MIP_06405         CDS       T02325                                 

Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mid  Mycobacterium intracellulare subsp. intracellulare
Pathway
mid00250  Alanine, aspartate and glutamate metabolism
mid00410  beta-Alanine metabolism
mid00430  Taurine and hypotaurine metabolism
mid00650  Butanoate metabolism
mid01100  Metabolic pathways
mid01110  Biosynthesis of secondary metabolites
mid01120  Microbial metabolism in diverse environments
mid02024  Quorum sensing
Module
mid_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mid00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    MIP_06405
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MIP_06405
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MIP_06405
   00430 Taurine and hypotaurine metabolism
    MIP_06405
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    MIP_06405
Enzymes [BR:mid01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     MIP_06405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AFS16303
UniProt: J9WJE5
LinkDB All DBs
Position
complement(4631009..4632391)
Genome map
AA seq 460 aa AA seqDB search
MPQHPSLPAHSIAPAYTGRLFTAPVPALRMPDESMDPDAAYRFIHDELMLDGSSRLNLAT
FVTTWMDPEAGKLMAETFDKNMIDKDEYPATAAIEQRCVCMVADLFHADGLNDADPYSAC
GVSTIGSSEAVMLGGLAMKWRWRAKIGKDWKGRTPNLVMGSNVQVVWEKFCRYFDVEPRY
LPMEEGRYVITPEQVVDAVDENTIGVVAILGTTYTGELEPVADICGALDKLAAGGGVDVP
VHVDAASGGFVVPFLHPELKWDFRLPRVVSINVSGHKYGLTYPGVGFVVWRSKEYLPDDL
VFRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGREGYTKVMQALSGTARWLGEQLRV
SEHCELVSDGSAIPVVAFRLSKDRGYTEFDVSHELRTYGWQVPAYTMPDNATNVSVLRIV
VREGLSADLARALHDDAVSALSSLDKLRPGGHYADQHFAH
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
gtgccacaacacccttcgctgcccgcgcactccatcgcccccgcctacacgggccggctg
ttcaccgcaccggtccccgcactgcggatgcccgacgaatcgatggatcccgacgccgcc
taccgcttcatccacgacgagctgatgctcgacgggagttcgcggctgaacctggccacc
ttcgtcaccacctggatggaccccgaggccggcaagctgatggccgagacgttcgacaag
aacatgatcgacaaggacgagtacccggcgaccgcggccatcgagcagcgctgcgtgtgc
atggtggccgacctgttccacgccgacggcctgaacgacgccgacccctacagcgcgtgc
ggggtgtccacgatcggctccagcgaggcggtgatgctcggcgggctggcgatgaagtgg
cggtggcgcgcgaaaatcggcaaggactggaagggccgcaccccgaacctggtgatgggg
tccaacgtccaggtggtctgggagaagttctgccgctacttcgacgtcgagccccgctac
ctgccgatggaggagggccgctacgtcatcacccccgaacaggtcgtcgacgccgtcgac
gagaacaccatcggcgtggtggcgatcctgggcaccacctacaccggcgagctggagccg
gtcgccgacatctgcggcgcgctggacaagctggccgccggcggcggtgtggacgtcccg
gtgcacgtcgacgccgccagcggcgggttcgtggtgcccttcctgcaccccgagctcaag
tgggatttccggctgccccgggtggtgtcgatcaacgtcagcggccacaagtacgggctg
acctatcccggcgtcgggttcgtggtgtggcgcagcaaggagtacctgcccgacgacctg
gtgttccgggtcaactacctcggcggcgacatgccgaccttcacgctgaacttctcccgc
cccggcaaccaggtggtcggccagtactacaacttcctgcggctcggccgggagggctac
accaaggtcatgcaggcgctgtccgggacggcgcgctggctcggtgagcagctgcgggtc
agcgagcactgcgagctggtctccgacggctcggcgatccccgtggtcgcgttccggctg
tccaaggaccgcggctacaccgagttcgacgtctcccacgagcttcggacctacggctgg
caggtgcccgcctacaccatgccggacaacgccaccaacgtctccgtgctgcgcatcgtg
gtgcgcgagggcctgtccgccgacctggcccgggccctgcacgatgacgccgtctcggcg
ctcagttcgctggacaagctccggcccggcggccactacgcggatcagcacttcgcgcac
tga

DBGET integrated database retrieval system