KEGG   Methanotorris igneus: Metig_1728Help
Entry
Metig_1728        CDS       T01510                                 

Definition
(GenBank) Alpha-amylase
  KO
K07405  alpha-amylase [EC:3.2.1.1]
Organism
mig  Methanotorris igneus
Pathway
mig00500  Starch and sucrose metabolism
mig01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mig00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Metig_1728
Enzymes [BR:mig01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Metig_1728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57 Polysacc_deac_1
Motif
Other DBs
NCBI-ProteinID: AEF97260
UniProt: F6BBY0
LinkDB All DBs
Position
complement(1774310..1775530)
Genome map
AA seq 406 aa AA seqDB search
MLISFNFEVHQPRRLRKYIKKDSENLWERYVDDELNREIFNRVANKCYIPANRIILDLID
NYDFKISYSITGVFLEQAMAFNDDVLDLFKDLVKTGNVELICETYYHSLSSLFENHEEFV
EEIKLHQKIIKEVFGYKPKVFRNTELIYHNKIAETIKKLGFEGIFTEGTEKVLEWRSPNY
VYEALCGLKVLLRNYRLSDDIGFRFSCQNWEEYPLTADKYALWLSKTPGDCINIYMDYET
FGEHQWRETGIFEFLKHLPQEIEKYEHLQFATPSEILKKCKTRGKIDVFEFSTISWADTE
RNVSAWLGNRMQKISFEKLKEIGKYIKEHKESIKNYEDVYKIYKILQTSDNFYYMCTKGL
SDMDVHSYFSHFETPFDAYASYLNILYDFESYIVTNQKLNGYTFLP
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgctaatttcttttaactttgaagtccatcaacctcgcaggttaagaaaatatataaaa
aaagatagcgaaaatttgtgggagagatatgttgatgatgaattaaacagagagatcttc
aatagagttgctaataaatgctacataccagcaaatagaataatattggatttgatagac
aattatgacttcaagatatcatacagcataactggtgtgtttttagagcaggctatggca
tttaatgatgatgttttagaccttttcaaagatttggtaaaaacgggaaatgtagaactg
atatgtgagacgtattaccactctctctcaagtctttttgaaaaccatgaagaatttgta
gaagagataaaactacaccaaaaaatcattaaagaagtttttggatacaagccaaaggta
tttaggaacacagagctaatctatcataacaaaatagcagaaaccatcaaaaaattgggt
tttgaaggtatattcacagaaggtactgagaaagttcttgagtggaggtcgccaaattat
gtttatgaggccctttgtgggctaaaagtcctactaagaaattataggttaagtgacgat
attggatttagattttcttgtcaaaattgggaagaatatccactaacagcagataaatat
gcgttatggctttcaaaaactccaggagattgtataaacatttacatggactatgagacc
tttggagaacaccaatggagagaaacaggtatatttgaatttctaaaacatcttccccaa
gaaattgagaagtatgagcatttgcagtttgcaacgccatcagaaatactaaaaaaatgt
aagacaaggggaaaaattgatgtttttgagttttcaacaatttcttgggcagatactgaa
aggaatgtaagtgcatggcttggaaatagaatgcagaagatttcatttgaaaaattaaaa
gaaattggaaaatacataaaagaacataaagaatccataaaaaactacgaagatgtatac
aaaatatacaaaattctacaaaccagtgacaatttctactacatgtgcacaaaaggtctc
agtgatatggatgtgcattcctactttagccactttgagaccccatttgatgcatatgca
tcctatctaaatatcctatatgattttgaaagttatatcgttacaaatcaaaaattgaac
ggctatacttttcttccttaa

DBGET integrated database retrieval system