KEGG   Microbacterium sp. BH-3-3-3: BJP65_15050Help
Entry
BJP65_15050       CDS       T04827                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mih  Microbacterium sp. BH-3-3-3
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mih00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BJP65_15050
  Energy metabolism
   00680 Methane metabolism
    BJP65_15050
Enzymes [BR:mih01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BJP65_15050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(3272088..3274760)
Genome map
AA seq 890 aa AA seqDB search
MRELTPTEAIDLVGRFEAGQELPEQMRADVRLLGSLLGRVLQESGSPGLYDDVERLRSAT
IQAYTDETPEAFERAAAIADGFSIARADEVARAFTAYFHLVNLVEEHQRVRVLRERGDNP
SRSGTPDTIATAYERLSSEVGEETALARLQALRFHPVFTAHPTEARRRAISTSIRRLSEL
LAEHDAASDGGTESRRTERRMLEEIDTLWRTAPLRREKPSPVDEVRSVMSVFDETLYTAV
PRVYRRIDDILQGEHAGSRAPIVKPFVRVGSWVGGDRDGNPFVTASVTRKAAAIASEHVL
LGLERTTQRVGRGLTLDAESTPPSDVLVTLWHRLRAADEDAAAEIAERSPDEPHRRIMLL
LARKIAATRSRNADLAYRDPEHLLADLRTVQDSLVAAGAARQAYGALQRLVWQVETYGFH
LTELEVRQHSAVHRKVLEELRAGGGRSEQTDEVLEVFRSIAYVQERFGPRAAGRYIVSFT
QSAEDLANVHELAAFAMGPGEDVPVLDVIPLFETFADLQAAPGILAEIVSHPSFVSRLDA
TGRRLEVMLGYSDSSKDVGPVAANLALYEAQAKISTWAETEGIELTLFHGRGGALGRGGG
PANSAILAQPPHSVDGRFKLTEQGEVIFARYGDADIAMRHIDQVAAAVLTASSPSIERRN
RGAAEAFADVASTMDVASRERFFALVKAPGFAPWFATVTPMEELGHLALGSRPARRGLSV
ESLEDLRAIPWVFSWTQARINLAGWFGLGTALDAVGDEPRLRDAYEQWPLFRTMIDNVAM
SLAKADERIARRYLALGDRDDLAGLVMDEMLLTRSWVERITGGDLLGNKPVLQRAVKMRS
PYVDALSLLQLRALRALRDAANTSETPDAEQQRLLLLSVSGVAAGLQNTG
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtgaactgaccccgaccgaggccatcgacctcgtgggccgcttcgaagccggccaa
gagctccccgaacagatgcgcgccgacgtgcgcctgctcggctcgctgctcggccgcgtc
cttcaggagagcggctcccccggcctgtacgacgatgtcgagcggctgcgctcggcgacg
atccaggcctacaccgacgagacgcccgaagcgttcgagcgggccgcggcgatcgccgac
ggcttctcgatcgcgcgggccgacgaggtggcccgtgccttcacggcctacttccacctc
gtcaacctcgtcgaggagcaccagcgcgtgcgcgtgctgcgcgagcgaggagacaacccg
tcgcgctccggcacgcccgacaccatcgcgacggcatacgagcggctgtcgagcgaagtg
ggcgaagagaccgcgctcgcgcgcctccaagcgctgcgcttccacccggtcttcacggct
caccccaccgaagcccgccgccgcgcgatctccacgagcatccgtcgcctgtcggagctg
ctcgccgagcacgacgccgcctccgacggtggcaccgagagccgtcgaaccgagcgccgc
atgctcgaagagatcgacacgctgtggcgcaccgctcccctccggcgcgagaagccgtcg
cccgtcgacgaggtgcgctcggtcatgtcggtgttcgacgagacgctctacaccgccgtg
ccgcgcgtgtaccgccgcatcgacgacatcctgcagggcgagcacgccggttcccgcgcc
ccgatcgtgaagccgttcgtgcgcgtcggctcgtgggtgggtggcgaccgcgacggaaac
cccttcgtcacggcatccgtcacccgcaaggccgccgcaatcgcgagcgagcacgtgctg
ctgggcctcgaacgcaccacgcagcgcgtgggtcgcggactgaccctcgatgccgagtcc
acgccgccgagcgatgtcctcgtcaccctgtggcaccgtctgcgcgccgccgacgaagac
gccgcggccgagatcgccgagcgctcccccgacgaaccccaccgccgcatcatgctgttg
ctcgcacgcaagatcgccgcgacccgttcccgcaacgccgacctcgcgtaccgcgacccc
gagcaccttctcgccgatctgcggacggtgcaggattcactcgtcgccgcgggagccgca
cgtcaggcctacggcgccctgcagcgcctggtgtggcaggtcgagacctacggcttccac
ctcaccgagctcgaggtgcgacagcactcggccgtgcaccggaaggtgctcgaagagctc
cgcgcgggcggtggccgcagcgagcagaccgacgaggtgctcgaggtcttccgttccatc
gcctacgtgcaggagcgcttcgggccccgcgccgccggtcggtacatcgtgtcgttcacg
cagtcggccgaagacctggccaacgtgcacgaactggccgcgttcgcgatgggcccgggt
gaggacgtgcccgttctcgacgtcatccctctcttcgagaccttcgccgacctgcaggcc
gcccccggcatcctcgccgagatcgtgtcgcatccgtcgttcgtcagtcgactggatgcc
acgggccggcgcctcgaggtcatgctgggttactccgactcctccaaagacgtcggaccg
gtcgcggcgaacctcgcgctgtacgaggcgcaggcgaagatctcgacgtgggccgagacc
gagggcatcgagctgacgctcttccacggtcgcggtggtgcgctcggacgaggcggcgga
cccgccaactccgcgatcctcgcgcagcccccgcactccgtcgacggccggttcaagctc
accgagcagggcgaggtcatcttcgcccgctacggcgatgccgacatcgccatgcgccat
atcgatcaggtcgcggcggccgtgctcacggcctcctccccctcgatcgagcgccgcaac
cgtggggccgctgaggcgttcgccgatgtcgcgagcacgatggacgtcgcctcgcgggag
cgtttcttcgccctcgtgaaggctcccggcttcgcaccgtggttcgccacggtcacgccg
atggaagagctcggtcacctggcattgggctctcgccccgcgcgacgcggcctctcggtg
gagtcgctcgaagacctccgggccattccctgggtgttctcgtggacgcaggcgcgcatc
aacctcgccggatggttcggcctgggcacggcgctcgacgccgtcggcgatgagccgcgc
ctgcgcgacgcgtacgagcagtggccgctgttccgcaccatgatcgacaacgtcgcgatg
agcctcgcgaaggccgacgagcgcatcgcccgccgctacctggcactcggcgaccgtgac
gacctcgcggggctcgtgatggacgagatgctgctcacccggtcgtgggtcgaacgcatc
accggcggcgacctgctgggcaacaaacccgtgctgcagcgcgcggtcaagatgcgcagc
ccctacgtcgacgcgctctcgctgctgcagttgcgggcgctccgcgccctgcgcgacgcg
gcgaacacctccgagacaccggatgccgaacagcagcgcctgctgctgctgtcggtgagc
ggtgtggccgcgggactccagaacaccgggtga

DBGET integrated database retrieval system