KEGG   Microbacterium sp. BH-3-3-3: BJP65_15745Help
Entry
BJP65_15745       CDS       T04827                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
mih  Microbacterium sp. BH-3-3-3
Pathway
mih03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mih00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    BJP65_15745
Enzymes [BR:mih01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BJP65_15745
DNA repair and recombination proteins [BR:mih03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BJP65_15745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M LigD_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AOX47051
LinkDB All DBs
Position
complement(3424447..3426942)
Genome map
AA seq 831 aa AA seqDB search
MTEQTVRIGGRRLRLSNLDKVLYPETGTTKGEVIDYYSRIAPRLLPHVRDRPVTRKRWPD
GVGTDADPGEPFFAKALEPGAPAWVRRLPIDHSSGAKDYPLVDDLPTVVYLAQVASLELH
VPQWRFSADGERLHPDRLVLDLDPGPGVGLAECAEVARWARVILQDIGLDPLPVTSGSKG
IHLYAHLDGRQSSDAASAIAKELARAIEADHPDLVVSQMSKSARPGKVFIDWSQNNGSKT
TIAPYSLRGRSHPTVAAPRTWEELDDPGLRHLLFTEVLDRPGDPLAPVERDAGPLRAYIS
KRTAGATPEPVPDAPHADAAPDGLPRFVIQEHHATRLHWDVRLEHDGVLVSWAVPKGVPP
TTAKNSLAVMTEDHPMQYLDFAGEIPRGEYGAGIMTVWDTGTYELEKWRDDEVIATLEGG
PDGPLGRVRLALIRTEGAGEKSQWLLHRMKTDAEGRPQSDGDPVVALDHGRADRVAVTVT
ATESDEAPEPEPAPEPAPGTSTPPAPPSPAQLRPMLSTAATAGIARAAADRWGEPWVEMK
WDGIRGIGLWDGERLRLRSRNGNDLTAAYPELTTVDLGLGPEPAVVDGEIVALDAQGRPS
FPLLQRRMNLAQPREIEREARRTPVQLYLFDVLSVGERDVAALPLTERRGILEALAQDAG
APVVVPPVFDDVDAAVATSGRFGLEGVVVKDPGSVYRRGERSEQWLKVKHSRTQEVVIGG
VRPGKGNRAGTIGSLLVGVPGPDGLQYAGRVGSGFGDQTLARLGEMLAALGSDTDPFVGV
PAADARDALWVRPELVAEVEFAEFTPGGILRQARWRGLRPDKDPGEVVREV
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
atgacggagcagacggtgcgcatcggcggacgccgcctgcgtctgtcgaacctcgacaag
gtgctgtaccccgagaccgggaccaccaagggcgaggtgatcgactactactcccgcatc
gccccgcgcctgctcccccacgtgcgagatcgtcctgtcacgcgcaagcgctggcccgac
ggggtcggcaccgacgccgacccgggcgagcccttcttcgccaaggccctcgaacccgga
gcgccggcctgggtgcggcgcctgccgatcgaccactcctcgggcgccaaggactacccc
ctcgtcgacgatctgcccaccgtcgtctacctggcgcaggtcgcgagcctcgagctgcac
gtgccccagtggcggttctctgccgacggcgagaggctccaccccgaccgattggtgctc
gacctcgaccccggacccggcgtcggcctggccgagtgcgccgaggtggcccggtgggca
cgcgtcatcctgcaggacatcggtctcgaccccctgccggtgacgagcggaagcaagggc
atccacctctacgcgcacctcgacggccgccaatcgagtgatgccgccagcgcgatcgcg
aaagaactcgcccgggcgatcgaagccgaccaccccgacctggtggtcagccagatgtcg
aagtccgcgcgccccggcaaggtcttcatcgactggagccagaacaacggctcgaagacc
acgatcgcgccgtactcgctgcggggacgatcgcaccccaccgtcgccgccccgcgcacg
tgggaggagctcgacgacccgggcctacgtcacctgctgttcaccgaggtgctggatcgc
cccggcgatccgctcgcgccggtcgagcgcgacgcgggaccccttcgtgcgtacatctcc
aagcgcaccgcgggtgcgacccccgagcccgtgcccgatgccccgcacgccgacgccgca
cccgacggtcttccccgcttcgtcatccaagagcaccacgccacccgcctgcactgggac
gtacgactcgaacacgatggggtgctggtcagctgggccgtcccgaagggagtccccccg
acgacggcgaagaacagcctcgcggtcatgaccgaagaccaccccatgcagtacctcgac
ttcgccggcgagatcccccgcggcgagtacggcgccggcatcatgacggtgtgggacacg
ggcacctacgagctcgagaaatggcgcgacgacgaggtcatcgccaccctcgagggcggg
cccgacgggccgctcggccgagtgcgtctggccctcatccgcaccgagggcgcgggcgag
aagtcgcagtggctgctgcaccggatgaagacggatgccgagggtcggccgcagagtgat
ggcgacccggtggtggccctcgatcacggccgcgcggatcgggtcgcggtgacggtgact
gcgacggagagcgacgaggcgcccgagccggagcccgcgcccgagccggcgcccggcacc
tcgacgccgccggctcccccgagtcccgcgcagctgcgccccatgctgtccaccgccgcc
accgccgggatcgcccgggccgccgccgaccgctggggcgagccgtgggtcgagatgaag
tgggacggcatccgcggaatcggcctctgggacggcgagcggctgcgccttcgatcgcgc
aacggcaacgacctcaccgccgcctaccccgaactcacgaccgtcgacctcgggctcggc
ccggagcccgcggtcgtcgacggcgagatcgtcgcgctcgacgcgcagggacgcccgagc
ttccccctgctgcaaagacggatgaacctcgcgcagccccgcgagatcgagcgcgaagcc
cggcgcacaccggtgcagctgtacctgttcgacgtactttcggtgggcgagcgcgacgtc
gccgccctgccgctgaccgagcggcgcggcatcctggaggcactggcgcaggatgccggg
gcccccgtcgtcgtgccgcccgtgttcgacgacgtcgacgccgccgtcgcgacgagcggc
cggttcgggctcgagggcgtcgtggtcaaggaccccggttcggtataccgccgcggcgag
cgttcggaacagtggctcaaggtgaagcactcgcgtacgcaggaggtcgtgatcggcggc
gtccgcccgggcaagggcaaccgcgcgggcacgatcgggtcgctcctggtcggtgtcccc
ggaccggacggcctgcagtacgccggccgcgtcggctcgggtttcggtgaccagaccttg
gccagactcggcgagatgctcgccgcgctgggaagcgacaccgacccgttcgtgggggtg
cccgccgccgatgcccgcgacgcgctgtgggtgcggcccgaactcgtcgccgaggtggag
ttcgcggagttcacccccggcggcatcctgcgccaggcacgctggcggggcctgcggccc
gacaaggatccgggcgaggtggtgcgggaggtctga

DBGET integrated database retrieval system