KEGG   Microbacterium sp. PAMC 28756: AXH82_11670Help
Entry
AXH82_11670       CDS       T04312                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mip  Microbacterium sp. PAMC 28756
Pathway
mip00620  Pyruvate metabolism
mip00680  Methane metabolism
mip01100  Metabolic pathways
mip01120  Microbial metabolism in diverse environments
mip01200  Carbon metabolism
Module
mip_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mip00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AXH82_11670
  Energy metabolism
   00680 Methane metabolism
    AXH82_11670
Enzymes [BR:mip01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AXH82_11670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AMG83976
LinkDB All DBs
Position
complement(2456963..2459704)
Genome map
AA seq 913 aa AA seqDB search
MTPDSPAFSEPTPTEAIRVIGRFEAGRGIPDAMRSDVRMLGQLLGQVLREAGGDDLFEDV
ERLRLATIQAYEDHSSDAFDRAAAIADSFTIARADEVARAFTCYFHLVNLAEEHQRVRVL
RERAGQTPSTSSGTQVGSGPSTGSGAQATDTVAGAYARLREEVGDDEARRRLDGLRFHPV
FTAHPTEARRRAVSSSIRRLSELLTQHDVASAGGSEEHRARRRMLEEIDTLWRTAPLRAQ
KPSPTDEVRTVMGVFDETLFTTVPHVYRRIDDALRGEESGATAPVVPAFVRIGSWVGGDR
DGNPFVTAAVTREASQIASDHVLRGLERALDRIGRTLTLAADDTPPSAEVTALWERFAAA
EPTVADELAARSPDEPHRRVVLVMARRVAATRRGDEEGYTGPEELLAELRTVQSSLVAAG
ARRHAFGGVQHLIWQVETYGFHLTELEVRQHSQVHAKALAELEAGGPISTQTEEVLEVFR
AIADIQRDRGLRAAGRYVVSFTQAASDLANVYELARHALGDDAPVLDVVPLFETFADLQA
APGILAEAVTFPEFRERMAATGNRLEVMLGYSDSSKDVGPVAANLALYTAQEKIARWAQE
SGIELTLFHGRGGALGRGGGPANSAILAQPPHSVDGRFKLTEQGEVIFARYGEPAIAMRH
IDQVAAATLLASSPTVEERTSRAAARYAEVAAMMDAASRERFFALVKAEGFAPWFATVTP
MEEIGLLALGSRPARRGLSVESLEDLRAIPWVFAWTQARINLAGWFGLGTALEAVGDEEL
LTEAYREWPLLRTMVDNVAMSLAKTDERIARQYLALGDRDDLAALVLDELALTRRWVIRL
TGGEGLLENKPVLQRAVQLRSPYVDALSLLQLRALRALRSAPEQPEGSGADAEQQRLLLL
SVSGVAAGLQNTG
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
gtgacccccgattcccccgctttctccgagccgacgcccaccgaggccatccgcgtgatc
ggtcgtttcgaagccggtcgcggcatccccgatgccatgcgctccgacgtgcggatgctg
ggccagctcctcggccaggtgctccgcgaggccggcggcgacgacctgttcgaggacgtc
gagcgcctgcgcctcgcgacgatccaggcctacgaggaccacagctccgacgcgttcgac
cgcgccgcggcgatcgccgactccttcacgatcgcccgtgccgacgaggtcgcccgcgcg
ttcacctgctacttccacctcgtgaacctggccgaggagcaccagcgcgtgcgcgtgctc
cgggagcgggcggggcagaccccttcgacaagctcagggacccaggtgggctcgggccct
tcgacgggctcaggggcccaggcgacggacacggtcgcgggggcgtacgcccggctgcgc
gaggaggtcggcgacgacgaggcccgccgtcgtctggacggcctgcgcttccaccccgtc
ttcacggcccacccgaccgaggcccggcgccgcgcggtctcgtcgagcatccgccgcctc
tcggagctgctcacccagcacgacgtggcaagcgcaggcggctccgaggagcaccgcgcg
cgccgccggatgctcgaggagatcgacaccctgtggcgcacggcgccgctgcgcgcgcag
aagccctccccgaccgacgaggtccgcaccgtcatgggcgtcttcgacgagacgctgttc
accacggtcccccacgtctaccgccggatcgacgacgccctccgcggcgaggagtccggc
gccaccgccccggtcgtcccggcgttcgtgcggatcggttcctgggtcggcggcgaccgc
gacggcaacccgttcgtcaccgccgcggtcacccgcgaggcgtcgcagatcgcctccgac
cacgtgctccgcggcctggagcgggcgctcgaccggatcggccgcaccctcacgctcgcc
gcggacgacaccccgcccagcgccgaggtcacggcactctgggagcgtttcgcggccgcg
gagccgacggtcgccgacgagctcgcggcccgttcccctgacgagccgcaccgccgggtc
gtcctcgtcatggcccgccgcgtggcggccacgcgccgcggagacgaggagggctacacg
ggtccggaggagctgctcgcggagctgcgcaccgtgcagtcctccctcgtcgccgccgga
gcccgccgtcacgcgttcggcggcgtgcagcacctgatctggcaggtcgagacctacggc
ttccacctcacggagctggaggtgcgccagcactcccaggtgcacgccaaggccctggcc
gaactcgaggccggcggtccgatcagcacgcagaccgaggaggtgctggaggtgttccgc
gcgatcgcggacatccagcgcgaccgcgggctgcgcgccgcgggtcgctacgtcgtctcc
ttcacgcaggcggcctccgacctcgcgaacgtgtacgagctggcccgtcatgcgctcggc
gacgacgccccggtgctcgacgtcgtgccgctgttcgagaccttcgccgacctccaggcc
gccccggggatcctcgccgaggccgtcaccttcccggagttccgcgagcggatggccgcg
accggcaaccggctggaggtcatgctcggctactccgactcctccaaggacgtcgggccc
gtggccgcgaacctcgcgctgtacacggcgcaggagaagatcgcccgctgggcacaggaa
tcgggcatcgagctcaccctcttccacggccgcggcggtgcgctcggccgtggcggcggc
cccgccaactccgcgatcctcgcgcagcccccgcactccgtcgacggtcggttcaagctc
accgagcagggcgaggtcatcttcgcccgctacggcgagcccgcgatcgcgatgcggcac
atcgaccaggtcgccgccgcgacgctgctcgcttcctcccccacggtcgaggagcgcacg
agccgcgcggccgcccgctacgccgaggtcgccgcgatgatggacgccgcctcccgcgag
cggttcttcgcgctcgtcaaggccgagggcttcgccccgtggttcgcgaccgtgaccccg
atggaggagatcggcctgctcgcgctcggctcgcggcccgcccgtcgtggcctctcggtg
gagtcgctggaagacctccgggccatcccctgggtgttcgcgtggacgcaggcccggatc
aacctcgccggctggttcggactcggcaccgcgctcgaggccgtcggcgacgaggaactg
ctcacggaggcctatcgcgagtggccgctgctgcgcacgatggtcgacaacgtcgcgatg
agcctcgccaagaccgacgagcgcatcgcccggcagtacctcgccctcggcgaccgcgac
gacctcgccgccctggtgctcgacgagctcgcgctcacccgtcgctgggtcatccgtctc
accggaggcgagggcctgctggagaacaagcccgtgctgcagcgggccgtgcagctgcgc
agcccgtacgtcgacgccctctccctcctgcagctgcgggcgctccgcgcgctccgttcg
gcgccggagcagccggagggctccggcgcggacgccgaacagcagcgcctgctcctcctg
tccgtcagcggggtcgccgccggcctgcagaacaccgggtga

DBGET integrated database retrieval system