KEGG   Micromonas commoda: MICPUN_103896Help
Entry
MICPUN_103896     CDS       T02695                                 

Definition
(RefSeq) predicted protein
Organism
mis  Micromonas commoda
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: An_peroxidase
Motif
Other DBs
NCBI-GeneID: 8248513
NCBI-ProteinID: XP_002505813
JGI: MicpuN3_103896
UniProt: C1EFE3
LinkDB All DBs
Position
13:complement(join(795275..797015,797163..797254))
Genome map
AA seq 610 aa AA seqDB search
MAAAASRIELALCFEDVAKNIFGNADGTMTRAQLAAILAADTGLGLQQWELKMFLAEFDL
TDNRVTADKFCSIYSYLASRPPTPAAKDAPAVVAAVAAAPAPGPDPAASAAPADPAAAPA
AAAAPVAVDPALAKRASEKLSGPAAAAVTSMGAAFPPDFLLDPAGAIPAEKLLANLPGDV
YADPDAKFRPFDGVGQYAKMPILGGCGAPYSVCVKSSREYLRDLPPARDVVRLLHLRPDD
DAFVPHPNGISVVLLAFAKLVSADLGLGGDSLAANNPMSSYLDLQVLYGTNAGECDDVRG
GTARGKILPDAAAGRGHVGGAAMEALLTVFSRNHNHLAEAIAAECGDADDESVFQMARHA
NIGAYRSVFLKDFLPYLAAGQHTPDVAPIGDAARGTVRGVNGCVEMDLLMRTFNAMEPPG
GMGGTGTGDGTGDACAAALAEASNVRCGLVARCNLPGRLHAEEVAAVKRARASGVCTLNE
FRAQLGLAAWESFEEMTGGETSLCEKLTAVYGDVDNCELYTGLLCEYNVGNVGAMMPATS
HACSLLLNVVAADKWFQEDALRDESVMGGAVGVRLAEQANLEDLLSQHARVAPPEGGYGV
FEIGGYQVLP
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggccgcatcgcgaatcgagctcgcactctgcttcgaggatgtcgccaagaac
atcttcggcaacgccgacggcaccatgaccagggcccagctggcggctatcctcgccgcg
gacaccggcctcggcctgcagcagtgggagctcaagatgttcctcgccgagtttgacctc
accgacaacagggtcaccgcggacaaattctgctccatctactcgtacctcgcctcgcgt
ccaccgacgcccgcggcgaaggacgcgcccgcggtggtcgccgccgtcgccgccgcaccc
gcgcccggccccgacccggccgcttccgccgcccccgcagaccccgccgccgcacccgcc
gccgccgccgccccggtcgcggtcgatcccgccctggccaagcgggcgtcggagaagctc
tcgggtcccgccgccgccgccgtcacctcgatgggcgcggcgttcccgcccgatttcctc
ctggaccccgcgggcgccatccccgcggagaagctcctggcgaacctccccggcgacgtg
tacgcggacccggacgccaagttccgacccttcgacggcgtcggtcagtacgcgaagatg
ccgatcctcggcgggtgcggagctccgtactcggtgtgcgtgaagagctcgagggagtac
ctccgggatttgccccccgcgcgagacgtggtgcgcttactgcacctgaggcccgacgac
gacgccttcgtcccgcatcccaacggaatctccgtcgtgctcctcgcgtttgcgaaactc
gtctccgccgacctcggcctcggcggcgactccctcgccgccaacaacccgatgagctcc
tacctcgacctgcaggtgctctacggcaccaacgcgggggaatgcgacgacgtgaggggc
gggaccgcccggggtaagatcttaccggacgccgccgcgggccgcgggcacgtcggcggc
gccgcgatggaagcgctgctcaccgtcttttcccgtaaccacaaccacttggccgaggcc
atcgcggcggagtgcggggatgcggacgacgagtcggtgttccagatggccaggcacgcc
aacatcggcgcgtaccgctcggttttccttaaagactttttgccgtacctcgccgcgggt
cagcacacgccggacgtggcgccaatcggcgacgccgcgcgcgggactgttcgcggggta
aacgggtgcgtcgagatggacctcctgatgcgaaccttcaacgccatggagccccccggc
ggcatgggcggcacgggcacgggcgacggcaccggggacgcgtgcgccgctgcgctcgcg
gaggcgagcaacgtgagatgcggattagtcgcgcggtgcaacctcccgggcagacttcac
gccgaggaggtggcggcggtgaagcgcgcgagggccagcggcgtgtgcacgctgaacgag
tttcgcgcgcagctcgggctggcggcttgggaatcttttgaggagatgacgggcggcgag
acgtcgctgtgcgagaagctgacggcggtgtacggcgacgtggacaactgcgagctgtac
accggcctgctgtgcgagtacaacgtcggtaacgtcggcgcgatgatgccggcgacgtct
cacgcgtgttcgctgctgttgaacgtcgtcgccgcggataagtggttccaggaggacgcg
ctgagggacgagagcgtgatgggcggcgccgtgggcgtgaggctcgcggagcaggcgaac
ctcgaagacctgctgagccaacacgcgagggtcgcgccgcccgagggcggctacggcgtg
ttcgaaatcggtggatatcaggtattaccttag

DBGET integrated database retrieval system