KEGG   Mycobacterium intracellulare MOTT-02: OCO_36500Help
Entry
OCO_36500         CDS       T01754                                 

Definition
(GenBank) D-alanyl-alanine synthetase A
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mit00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    OCO_36500
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    OCO_36500
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    OCO_36500
Enzymes [BR:mit01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     OCO_36500
Peptidoglycan biosynthesis and degradation proteins [BR:mit01011]
 Precursor biosynthesis
  Amino acid ligase
   OCO_36500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(3880260..3881405)
Genome map
AA seq 381 aa AA seqDB search
MNASDRSTPHPGSGGGERARVAVVFGGRSNEHAISCVSAGSILRNLDPERFEVVAIGITP
EGSWVLTDGDPAALAITDRRLPEVTAESGTELALPADPRRGGQLVALPPGAGEVLASVDV
VFPVLHGPYGEDGTIQGLLELAGVPYVGAGVLASAAGMDKEFTKKLFAAEGLPVGDYAVL
RPSRARLRPEECQRLGLPVFVKPARGGSSIGVSRVASWDQLDAAVAAARRHDPKVIVEAA
IVGRELECGVLEMPDGTVEASALGEIRVAGVRGREDSFYDFATKYLDDAAELDVPAKVDD
EIADTVRQLAIRAFRAIDCQGLARVDFFLTEDGPVLNEINTMPGFTTISMYPRMWAASGV
DYPTLLATMVETALARGVGLR
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgccagcgatcggtcgacgccgcaccccggctcggggggcggcgagcgggcgcgc
gtggccgtcgtcttcggggggcgcagcaacgagcacgccatctcgtgcgtctcggcgggc
agcattctgcgcaatctcgaccctgagcgtttcgaggtggtcgcgatcggcatcaccccg
gaaggttcctgggtgctcaccgacggcgacccggccgcgctggcgatcaccgaccggcgg
ctgcccgaagtcaccgccgagtcgggaaccgaactggcgctgccggccgatccgcggcgc
ggcggccaattggtcgccctgccgcccggcgccggtgaggtgttggcgtccgtcgacgtg
gtgttccccgtgctgcacggcccctacggcgaggacggcaccatccagggtctgctcgaa
ctcgccggcgtgccgtatgtgggcgccggtgtgctggccagcgccgccggcatggacaag
gagttcaccaagaagctgttcgccgccgagggattgccggtcggcgactacgcggtgctg
cgcccctcgcgcgcgcggctgcggcccgaggagtgccagcggctggggctgccggtgttc
gtcaaacccgcacggggaggttcctcgatcggtgtgagccgggtagcgagctgggaccag
ctggacgccgccgtcgccgcggcgcgccgccacgatcccaaagtcatcgtcgaggccgcg
atcgtcggccgcgagctggagtgcggtgtgctcgaaatgccggacggcacagtcgaagcc
agcgcgctcggcgagatccgggtggccggcgtgcggggtcgcgaggattcgttctacgac
ttcgccaccaaataccttgacgacgcagccgaattggacgtgcccgcaaaggtcgacgac
gaaatcgccgacacagtgcgccaattggcgatccgcgccttcagggccatcgactgccag
gggctggcgcgggtggatttcttcctcaccgaggacgggccggtgctcaacgagatcaac
acgatgccggggttcaccacgatctcgatgtacccgcggatgtgggcggccagcggcgtg
gactacccgaccctgctggcgacgatggtcgagacggcgctggcccgcggggtgggcctg
cgctag

DBGET integrated database retrieval system