KEGG   Mycobacterium intracellulare MOTT-02: OCO_41440Help
Entry
OCO_41440         CDS       T01754                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase 2
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mit00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    OCO_41440
Enzymes [BR:mit01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     OCO_41440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(4378253..4379965)
Genome map
AA seq 570 aa AA seqDB search
MSVLGPEQRQAAWDRLGAEQFDVVVIGGGVVGSGCALDAATRGLKVALVEARDFASGTSS
RSSKMFHGGLRYLEQLEFGLVREALYERELSLTTLAPHLVKPMPFLFPLTNRVWERPYVA
AGIFLYDRMGGAKSVPAQKHLTRAGALRLSPGLKRSSLIGGIRYYDTVVDDARHTMTVAR
TAAHYGAVVRTSTQVVALLREGDRVTGVRVRDSEDGAVTEVRGHVVVNATGVWTDEIQAL
SKQRGRFQVRASKGVHIVVPRDRIVSDVAIILRTEKSVMFVIPWGSHWIIGTTDTDWNLD
LAHPAATKADIDYILTTVNTVLAIPLTHADIDGVYAGLRPLLAGESEETSKLSREHAVAV
PAPGLVAIAGGKYTTYRVMAADAIDAAAQFIPARVAPSITEKVSLLGADGYFALINQAEH
VAELQGLHPYRVRHLLDRYGSLIGDVLALADDRPDLLDPIKEAPGYLRVEALYAVTAEGA
LHLEDVLARRMRISIEYSHRGVDCAREVADVVAPVLNWSAADIDREVANYTARVEAEVLS
QAQPDDVSADELRASAPEARAEILEPVPLK
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgtgctgggtccggaacagcgacaggcggcctgggaccggctgggcgccgagcag
ttcgacgtggtcgtgatcggcggcggcgtggtgggttcgggctgcgcgctggacgccgcg
acccgcgggctcaaggtggcgctggtggaggcgcgcgacttcgcctcgggcacctcgagc
cgctcgtcgaagatgttccacggcggcctgcgctacctcgagcaactggagttcggcctg
gtccgcgaggcgctctacgagcgcgagctgtcgctgaccacgctggcaccgcacctggtc
aagccgatgccgttcctgttcccgctgaccaaccgcgtgtgggaacggccctacgtcgcc
gccggcatctttctctacgaccggatgggcggcgcgaaatccgttccggcacaaaagcat
ttgacccgtgcgggcgcgttgcggttgagcccgggcctcaagcgcagctcgttgatcggc
ggaatccgttactacgacacggtcgtcgacgacgcccggcacacgatgaccgtcgcgcgc
accgcagcgcattacggcgcggtggtgcgtacctccacccaggtcgttgccctgctgcgc
gagggcgatcgggtgaccggggtgcgggtccgcgattccgaggacggcgcggtcaccgaa
gtccgcggccacgtggtggtcaacgcgaccggggtgtggaccgacgagatccaggcattg
tccaagcagcgcgggcgatttcaggtgcgggcctccaagggcgtgcacatcgtggtgccg
cgcgaccgcatcgtcagcgacgtcgcgatcatcctgcgcaccgagaagtcggtgatgttc
gtcatcccgtggggcagccactggatcatcggcaccaccgacaccgactggaatctcgac
ctggcccatcccgcggccaccaaggccgacatcgattacatcctcaccacggtcaacacg
gtgctggccatcccgctgacccacgccgacatcgacggggtgtacgccgggctgcggccg
ctgctggccggggagagcgaggaaacctcgaagctgtcccgcgagcacgccgtggcggtg
cccgcgccgggattggtggccatcgcgggcggcaagtacaccacctaccgggtgatggcc
gcggatgcgattgacgctgcggcccaattcattccggcgcgggtggcgccgtcgatcacc
gagaaggtcagcctgctgggcgccgacggttacttcgcgctcatcaaccaggccgagcac
gtcgccgagctgcaggggctgcacccctaccgggtgcgccacctgctggaccgctacggc
tcgctgatcggcgacgtgctggcgctggcggacgaccgccccgacctgctcgacccgatc
aaggaggcgccgggctacctgcgggtcgaggcgctctatgccgtgaccgccgagggggcc
ttgcatctggaggacgtcctggcccgccggatgcgcatctccatcgaatactcacaccgc
ggtgtcgactgcgcccgcgaggtcgcggatgtggttgcgccggtgctgaattggtccgcg
gcggacatcgaccgcgaggtcgccaactacaccgcccgggtggaggccgaggtgctgtcc
caggcccagcccgacgacgtgtcggccgacgaattgcgggccagcgcgcccgaggcccgc
gccgagatcctcgagccggtcccgctcaagtga

DBGET integrated database retrieval system