KEGG   Mycobacterium immunogenum: BAB75_27130Help
Entry
BAB75_27130       CDS       T04755                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
miz  Mycobacterium immunogenum
Pathway
miz00620  Pyruvate metabolism
miz00680  Methane metabolism
miz01100  Metabolic pathways
miz01120  Microbial metabolism in diverse environments
miz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:miz00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BAB75_27130
  Energy metabolism
   00680 Methane metabolism
    BAB75_27130
Enzymes [BR:miz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BAB75_27130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ANO06511
UniProt: A0A0N1LYH8
LinkDB All DBs
Position
5522384..5525173
Genome map
AA seq 929 aa AA seqDB search
MTEVTDLAPIGAVTRTQVGREATEPMREDIRLLGAILGDTVREQCGDEVFDLVERARVES
FRVRRSEIDRAELAQLFHGVDIHQAIPVIRAFTHFALLANVAEDIHRERRRVIHVAAGAP
PQDSSLAATYLKLDAAQIDSNRVAHALAGALVSPVITAHPTETRRRTVFETQHRITELMR
LRMHGLSQTEAGRDIDSELQRHILTLWQTALIRLSRLKIQDEIAVGLRYYPAAFFDVIPE
INAEVRTALRRRWPDAHLLSQPILRPGSWIGGDRDGNPNVTAEVVHLATSSAALTAVTHY
FEQLVALEQELSLSIRLVTVSPDLIALAELCGEADRADEPYRRAVRVIHARLTATAAQIL
DHMPEHDLDLGLAPYGTPDEFLADLDVVDASLRAHGSVVLADDRLYRLREAVRVFGFHLS
GLDMRQNSDIHEEVVSELLAWAGVHPDYRSLPEHERVEVLVTELRTRRPLIGDGAELSEL
ARKELDIVTAAARAVRVYGPEAVPNYIISMCQSVSDMLEAAILLKEAGLLDASRPRPFCP
VGIVPLFETIDDLQRGSAILEAALEIPLYRALVTARGESQEVMLGYSDSNKDGGYLAANW
ALYRAELDLVESARKTGIRLRLFHGRGGTVGRGGGPSYDAILAQPPGAVSGSLRITEQGE
VIAAKYAEPRTAHRNLETLLAATLESTLLDVEGLGAAADTAYEILDDLAARAQRTYRELV
HETPGFVDYFKASTPVNEIGALNIGSRPTSRKPTTSIADLRAIPWVLAWSQSRVMLPGWY
GTGTAIEQWIAEGDGRLEVLQQLYRQWPFFQTVLSNMAQVLAKSDMGLAARYAELVEDET
LRHRVFDKIVAEHDKTIAMHQLITGHEDLLADNPALARSVFNRFPYLEPLNHLQVELLRR
YRSGDQDELVQRGILLTMSGLATALRNSG
NT seq 2790 nt NT seq  +upstreamnt  +downstreamnt
atgactgaggttacggatcttgcaccgataggcgccgtcacccggacacaggtggggcgg
gaggccaccgaaccgatgcgtgaggacatccgtttgctcggcgcgatcctgggcgacacg
gtgcgcgagcagtgcggcgacgaagtctttgacctggtcgagcgggcgcgggtggagtca
ttccgggtgcgccgctcggagatcgaccgggcagaactggcacagctgttccatggtgtc
gacatccatcaggcaatccccgtgattcgggccttcacccatttcgcgttgttggccaac
gtcgccgaggacattcaccgggagcgccggcgtgtcatccacgtcgcggcgggcgcaccc
ccacaggacagcagtctcgccgccacatatctcaaactagatgccgcgcaaatagattcg
aaccgtgtcgcgcacgcattggcgggcgcgctggtatcacccgtgatcaccgcacacccc
accgagacccgccggcgcaccgtgttcgagacccaacatcgcatcaccgagctcatgcgg
cttcgtatgcacgggttatcgcagaccgaagccggccgcgatatcgacagtgagttgcag
cggcacatcctcacgctgtggcaaacggcactgatccggttgtcccggttgaagattcaa
gacgagattgcggtgggactgcggtactacccagcggccttcttcgacgtgatacccgag
atcaatgccgaggtccgcaccgcgttgcgccgccgctggccggatgctcatctgctcagc
cagccaattctgcgccccggctcctggatcggtggcgaccgcgatggaaatccgaacgtc
accgccgaggtggtgcatctcgcgaccagcagcgccgcgctgaccgcggtcacccactat
ttcgaacaattggtggcactggagcaagagctgtccctttcgattcggctcgtcaccgtg
tcccccgacctgatcgcgctggccgagctgtgtggagaggccgaccgcgccgacgagccc
tatcgccgggccgtgcgggtcatccatgcgcgcctcaccgcgaccgccgcgcaaatcctc
gaccacatgccagagcacgatctggatctgggcctggcaccatacggcactccggacgaa
tttctggcggacctcgacgtcgtggacgcctccttgcgtgcgcacggcagcgtcgtgctg
gccgacgatcgtctgtacagactgcgggaagctgtgcgggtcttcggtttccacctcagc
ggcctggatatgcggcagaactcggacattcatgaagaggtggtgtccgaactactcgcg
tgggccggcgtgcatcccgactatcgatcgctgcccgagcacgagcgcgtcgaggtgctg
gtcaccgaactacgcactcgccgtcccttgatcggcgatggcgcggagctttccgagctc
gcccgcaaggaactcgacatcgtcacggctgccgcgcgggccgtacgggtttacggtccc
gaggcggtgcccaactacatcatctcgatgtgccaatcggtttcggacatgttggaggcg
gcaattctcctcaaggaggcaggcctgctggacgcctcccgcccgcgaccattctgtccg
gtgggcatagtgccgctgttcgaaacaattgacgacctgcaacgtggttccgcgattctc
gaagcagcactggaaattccgctgtaccgagccttggtgacagcccgcggcgagagccaa
gaggtcatgctggggtactccgattccaacaaggacgggggctacctggccgccaactgg
gccctgtaccgcgccgaactggacctggtggagtccgcgcgcaagaccggaatccgactg
cgcctcttccacggtcgtggtggcaccgtgggccgcggcggtggtccgagttatgacgcc
atcttggcgcaaccaccgggagcggtgtccggatcgcttcgcatcaccgaacagggcgag
gtgatcgccgccaagtacgccgaaccacgcactgcccatcgcaacctcgagacgctgttg
gccgcgaccttggaatcaacactgctcgatgtcgaaggattgggagcggcggccgacacc
gcctacgagatactcgatgacctcgccgcgcgcgcccagcgcacctatcgcgagctggtg
cacgaaacaccgggctttgtggactatttcaaggcatcgacgccggtcaacgagatcggc
gcgctgaacatcggcagtcggcccacatccaggaagcccaccacatcgatcgccgatctc
cgcgccatcccgtgggttttagcgtggagtcaatcgcgggtgatgttgcccggctggtac
ggcaccggcacggctattgaacagtggatcgccgaaggtgatgggcgacttgaggtattg
cagcagctctaccgtcagtggccgttctttcagacggtgctgtccaatatggcgcaggta
ctggccaagtccgatatggggttggccgcccgctacgccgaacttgtcgaggacgagacg
ctgcggcaccgggtcttcgacaagatcgtggccgaacacgacaagaccatcgccatgcat
caattgatcaccggacacgaggacctgctggccgacaacccggcactggcacgttcggtg
ttcaaccgctttccctatctggaaccgctcaaccacctacaagttgagctgctgcgtcgg
taccgctccggcgaccaggacgaactcgtgcaacgcggcatcctgctcacgatgagtggt
ctggccaccgcgctgcgcaacagcgggtaa

DBGET integrated database retrieval system