KEGG   Mycobacterium leprae TN: ML0072Help
Entry
ML0072            CDS       T00047                                 

Gene name
sodA
Definition
(RefSeq) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mle  Mycobacterium leprae TN
Brite
Enzymes [BR:mle01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ML0072 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 910514
NCBI-ProteinID: NP_301180
Pasteur: ML0072
UniProt: P13367
LinkDB All DBs
Position
complement(92647..93270)
Genome map
AA seq 207 aa AA seqDB search
MAEYTLPDLDWDYAALEPHISGEINEIHHTKHHAAYVKGVNDALAKLDEARAKDDHSAIF
LNEKNLAFHLGGHVNHSIWWKNLSPNGGDKPTGGLATDIDETFGSFDKFRAQFSAAANGL
QGSGWAVLGYDTLGNKLLTFQLYDQQANVSLGIIPLLQVDMWEHAFYLQYKNVKADYVKA
FWNVVNWADVQSRYMAATSKTQGLIFD
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaatacaccctgcccgatttggactgggactacgcagcgctggaaccacatatc
tctggtgagatcaacgagatccaccacaccaagcaccacgccgcatatgtcaaaggtgtc
aatgacgcgcttgccaaacttgacgaggcacgcgccaaagacgaccactccgcgattttt
ctgaacgagaagaacctggcctttcatttgggcggccacgtcaaccactccatctggtgg
aagaacctctctccgaacggtggcgataagccgaccggcgggctagccactgacattgat
gaaacgtttgggtcgttcgacaaattccgcgctcaattcagcgcggccgccaatggcctg
caagggtcaggttgggcagtactcggctacgacacgctcggcaacaagctgcttacattc
cagctgtatgaccaacaggccaacgtctcactcggcatcattcccttgttgcaggtcgac
atgtgggaacatgctttttacctgcaatacaaaaacgtcaaggcggattacgtcaaagcg
ttttggaatgtcgtaaactgggcggatgtgcagtcacgttacatggctgcaacatctaag
acgcagggactgatattcgactga

DBGET integrated database retrieval system