KEGG   Mycobacterium leprae TN: ML1678Help
Entry
ML1678            CDS       T00047                                 

Gene name
ddl
Definition
(RefSeq) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mle  Mycobacterium leprae TN
Pathway
mle00473  D-Alanine metabolism
mle00550  Peptidoglycan biosynthesis
mle01100  Metabolic pathways
mle01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mle00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    ML1678 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ML1678 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    ML1678 (ddl)
Enzymes [BR:mle01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ML1678 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:mle01011]
 Precursor biosynthesis
  Amino acid ligase
   ML1678 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 RimK ATPgrasp_ST ATP-grasp_4 CPSase_L_D2
Motif
Other DBs
NCBI-GeneID: 910044
NCBI-ProteinID: NP_302152
Pasteur: ML1678
UniProt: Q9CBS0
LinkDB All DBs
Position
complement(2021819..2022973)
Genome map
AA seq 384 aa AA seqDB search
MNVYQRPLMPWLPSGGRVRVAVVFGGRSNEHAVSCLSAGSILRNLDRQRFDVVAVGITPE
GTWMLTDPNPDALAIANRQLPAVSCESGIELTLPADPRRSGQLVSLSHGAGLGAGEVLTS
VDVVFPVLHGPYGEDGTIQGLLELARVPYVGAGVLASAAGMDKEFTKKLFAAEGLPLSAY
TVLRPLRPTLHRQECERLSLPVFVKPARGGSSIGISRVSSWGQLPSAIAYARRHDPKVIV
EAAVNGRELECGVLEMPDGTVAASAVGEIRVAGVSGSEDSFYDFTTKYLDDAAELDVPAK
VDDDVADEVRQLAIQAFRAIDCQGLARVDFFLTDDGPVINEINTMPGFTMTSMYPKLWAV
SSVDYPTLLATMVDTALARGVGMR
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgtctaccagcggcccttgatgccttggctgccatccggcggccgtgtgcgcgtt
gccgtcgtattcggcgggcgcagtaacgaacacgccgtctcctgtctgtctgccggcagc
atcttgcgcaatctggatcgacagcggtttgacgtggtcgcggttggtatcactccggaa
gggacgtggatgctcaccgatcccaacccggatgcgctggcgattgccaatagacagctt
cccgctgtgagctgcgaatcgggaatcgagttgacgctgccggccgatccacggcgcagc
ggtcaactggtgtcactttcacacggcgccggccttggggccggagaggtcctgacgtcg
gtcgatgtggtattcccggtgttacatggtccatatggcgaggacggcaccatccagggg
ctgctggaactcgctcgtgtgccctacgtcggagctggtgttctggccagcgccgccggc
atggacaaggaattcactaagaagctcttcgctgcggagggactgccgttgagcgcgtac
acggtgttgcgtccgttgcggccaacgctgcatcggcaggagtgtgagcggttgagttta
ccggtattcgttaaacccgcacgcggtggctcgtctatcggtatcagccgggtgtcgagc
tggggtcaactgccctccgcgattgcctacgctcgccggcacgatccgaaggtgattgtc
gaggcggcggttaacggccgcgaactggagtgcggcgtgctcgaaatgccggatggcact
gtggcagccagcgcggtgggggaaattcgggtagccggggtgagcggaagcgaggattcg
ttctacgacttcaccaccaaatatctcgacgacgcagccgagttagatgtgcccgccaag
gtggacgatgacgttgctgacgaggtgcgccagctcgcgattcaggcgtttcgggctatc
gactgccagggcctggcacgagttgactttttcctaaccgacgacgggccggtgatcaat
gagatcaacacgatgccggggttcaccatgacctcgatgtacccaaagctgtgggcggtc
agtagcgtggactacccgacgttgctagcgaccatggtggatacggcattggctcggggt
gtgggtatgcgttag

DBGET integrated database retrieval system