Mandrillus leucophaeus (drill): 105529326 Help Entry 105529326         CDS       T08763                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism mleu  Mandrillus leucophaeus (drill) Pathway mleu04613   Neutrophil extracellular trap formation mleu05034   Alcoholism mleu05202   Transcriptional misregulation in cancer mleu05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mleu00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105529326  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     105529326   09163 Immune disease    05322 Systemic lupus erythematosus     105529326   09165 Substance dependence    05034 Alcoholism     105529326  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mleu03036]     105529326   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mleu04147]     105529326 Chromosome and associated proteins [BR:mleu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105529326 Exosome [BR:mleu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105529326 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  105529326 NCBI-ProteinID:  XP_011821826 UniProt:  A0A2K5XBV3 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcgcgtactaagcagaccgctcgtaaatccacaggcggtaaagcaccgcgaaagcag ctggccactaaagcagctcgcaagagtgctccagccacgggtggcgtgaagaagcctcat cgctaccgccctggtaccgtggctttgcgcgagattcgtcgctaccagaagtccaccgag cttcttatccgaaagctgccgtttcagcgcctggtgcgagaaatcgctcaggacttcaag accgacctgcgctttcagagttccgctgtgatggcactgcaggaggcctgcgaggcttac ttggtggggctttttgaggacaccaacctgtgcgctatccatgccaaacgcgtcaccatc atgcctaaggatatccagcttgcccgccgcattcgtggcgagagagcgtaa

DBGET integrated database retrieval system