KEGG   Mandrillus leucophaeus (drill): 105550009
Entry
105550009         CDS       T08763                                 
Symbol
KRAS
Name
(RefSeq) GTPase KRas
  KO
K07827  GTPase KRas
Organism
mleu  Mandrillus leucophaeus (drill)
Pathway
mleu01521  EGFR tyrosine kinase inhibitor resistance
mleu01522  Endocrine resistance
mleu04010  MAPK signaling pathway
mleu04012  ErbB signaling pathway
mleu04014  Ras signaling pathway
mleu04015  Rap1 signaling pathway
mleu04062  Chemokine signaling pathway
mleu04068  FoxO signaling pathway
mleu04071  Sphingolipid signaling pathway
mleu04072  Phospholipase D signaling pathway
mleu04137  Mitophagy - animal
mleu04140  Autophagy - animal
mleu04150  mTOR signaling pathway
mleu04151  PI3K-Akt signaling pathway
mleu04210  Apoptosis
mleu04211  Longevity regulating pathway
mleu04213  Longevity regulating pathway - multiple species
mleu04218  Cellular senescence
mleu04360  Axon guidance
mleu04370  VEGF signaling pathway
mleu04371  Apelin signaling pathway
mleu04540  Gap junction
mleu04550  Signaling pathways regulating pluripotency of stem cells
mleu04625  C-type lectin receptor signaling pathway
mleu04650  Natural killer cell mediated cytotoxicity
mleu04660  T cell receptor signaling pathway
mleu04662  B cell receptor signaling pathway
mleu04664  Fc epsilon RI signaling pathway
mleu04714  Thermogenesis
mleu04720  Long-term potentiation
mleu04722  Neurotrophin signaling pathway
mleu04725  Cholinergic synapse
mleu04726  Serotonergic synapse
mleu04730  Long-term depression
mleu04810  Regulation of actin cytoskeleton
mleu04910  Insulin signaling pathway
mleu04912  GnRH signaling pathway
mleu04914  Progesterone-mediated oocyte maturation
mleu04915  Estrogen signaling pathway
mleu04916  Melanogenesis
mleu04917  Prolactin signaling pathway
mleu04919  Thyroid hormone signaling pathway
mleu04921  Oxytocin signaling pathway
mleu04926  Relaxin signaling pathway
mleu04929  GnRH secretion
mleu04933  AGE-RAGE signaling pathway in diabetic complications
mleu04935  Growth hormone synthesis, secretion and action
mleu04960  Aldosterone-regulated sodium reabsorption
mleu05010  Alzheimer disease
mleu05022  Pathways of neurodegeneration - multiple diseases
mleu05034  Alcoholism
mleu05160  Hepatitis C
mleu05161  Hepatitis B
mleu05163  Human cytomegalovirus infection
mleu05165  Human papillomavirus infection
mleu05166  Human T-cell leukemia virus 1 infection
mleu05167  Kaposi sarcoma-associated herpesvirus infection
mleu05170  Human immunodeficiency virus 1 infection
mleu05200  Pathways in cancer
mleu05203  Viral carcinogenesis
mleu05205  Proteoglycans in cancer
mleu05206  MicroRNAs in cancer
mleu05207  Chemical carcinogenesis - receptor activation
mleu05208  Chemical carcinogenesis - reactive oxygen species
mleu05210  Colorectal cancer
mleu05211  Renal cell carcinoma
mleu05212  Pancreatic cancer
mleu05213  Endometrial cancer
mleu05214  Glioma
mleu05215  Prostate cancer
mleu05216  Thyroid cancer
mleu05218  Melanoma
mleu05219  Bladder cancer
mleu05220  Chronic myeloid leukemia
mleu05221  Acute myeloid leukemia
mleu05223  Non-small cell lung cancer
mleu05224  Breast cancer
mleu05225  Hepatocellular carcinoma
mleu05226  Gastric cancer
mleu05230  Central carbon metabolism in cancer
mleu05231  Choline metabolism in cancer
mleu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mleu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mleu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105550009 (KRAS)
   04012 ErbB signaling pathway
    105550009 (KRAS)
   04014 Ras signaling pathway
    105550009 (KRAS)
   04015 Rap1 signaling pathway
    105550009 (KRAS)
   04370 VEGF signaling pathway
    105550009 (KRAS)
   04371 Apelin signaling pathway
    105550009 (KRAS)
   04068 FoxO signaling pathway
    105550009 (KRAS)
   04072 Phospholipase D signaling pathway
    105550009 (KRAS)
   04071 Sphingolipid signaling pathway
    105550009 (KRAS)
   04151 PI3K-Akt signaling pathway
    105550009 (KRAS)
   04150 mTOR signaling pathway
    105550009 (KRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105550009 (KRAS)
   04137 Mitophagy - animal
    105550009 (KRAS)
  09143 Cell growth and death
   04210 Apoptosis
    105550009 (KRAS)
   04218 Cellular senescence
    105550009 (KRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    105550009 (KRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    105550009 (KRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105550009 (KRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    105550009 (KRAS)
   04650 Natural killer cell mediated cytotoxicity
    105550009 (KRAS)
   04660 T cell receptor signaling pathway
    105550009 (KRAS)
   04662 B cell receptor signaling pathway
    105550009 (KRAS)
   04664 Fc epsilon RI signaling pathway
    105550009 (KRAS)
   04062 Chemokine signaling pathway
    105550009 (KRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105550009 (KRAS)
   04929 GnRH secretion
    105550009 (KRAS)
   04912 GnRH signaling pathway
    105550009 (KRAS)
   04915 Estrogen signaling pathway
    105550009 (KRAS)
   04914 Progesterone-mediated oocyte maturation
    105550009 (KRAS)
   04917 Prolactin signaling pathway
    105550009 (KRAS)
   04921 Oxytocin signaling pathway
    105550009 (KRAS)
   04926 Relaxin signaling pathway
    105550009 (KRAS)
   04935 Growth hormone synthesis, secretion and action
    105550009 (KRAS)
   04919 Thyroid hormone signaling pathway
    105550009 (KRAS)
   04916 Melanogenesis
    105550009 (KRAS)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    105550009 (KRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    105550009 (KRAS)
   04726 Serotonergic synapse
    105550009 (KRAS)
   04720 Long-term potentiation
    105550009 (KRAS)
   04730 Long-term depression
    105550009 (KRAS)
   04722 Neurotrophin signaling pathway
    105550009 (KRAS)
  09158 Development and regeneration
   04360 Axon guidance
    105550009 (KRAS)
  09149 Aging
   04211 Longevity regulating pathway
    105550009 (KRAS)
   04213 Longevity regulating pathway - multiple species
    105550009 (KRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    105550009 (KRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105550009 (KRAS)
   05206 MicroRNAs in cancer
    105550009 (KRAS)
   05205 Proteoglycans in cancer
    105550009 (KRAS)
   05207 Chemical carcinogenesis - receptor activation
    105550009 (KRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    105550009 (KRAS)
   05203 Viral carcinogenesis
    105550009 (KRAS)
   05230 Central carbon metabolism in cancer
    105550009 (KRAS)
   05231 Choline metabolism in cancer
    105550009 (KRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    105550009 (KRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105550009 (KRAS)
   05212 Pancreatic cancer
    105550009 (KRAS)
   05225 Hepatocellular carcinoma
    105550009 (KRAS)
   05226 Gastric cancer
    105550009 (KRAS)
   05214 Glioma
    105550009 (KRAS)
   05216 Thyroid cancer
    105550009 (KRAS)
   05221 Acute myeloid leukemia
    105550009 (KRAS)
   05220 Chronic myeloid leukemia
    105550009 (KRAS)
   05218 Melanoma
    105550009 (KRAS)
   05211 Renal cell carcinoma
    105550009 (KRAS)
   05219 Bladder cancer
    105550009 (KRAS)
   05215 Prostate cancer
    105550009 (KRAS)
   05213 Endometrial cancer
    105550009 (KRAS)
   05224 Breast cancer
    105550009 (KRAS)
   05223 Non-small cell lung cancer
    105550009 (KRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105550009 (KRAS)
   05170 Human immunodeficiency virus 1 infection
    105550009 (KRAS)
   05161 Hepatitis B
    105550009 (KRAS)
   05160 Hepatitis C
    105550009 (KRAS)
   05163 Human cytomegalovirus infection
    105550009 (KRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105550009 (KRAS)
   05165 Human papillomavirus infection
    105550009 (KRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105550009 (KRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    105550009 (KRAS)
  09165 Substance dependence
   05034 Alcoholism
    105550009 (KRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    105550009 (KRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    105550009 (KRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105550009 (KRAS)
   01522 Endocrine resistance
    105550009 (KRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mleu04131]
    105550009 (KRAS)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mleu04031]
    105550009 (KRAS)
Membrane trafficking [BR:mleu04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    105550009 (KRAS)
GTP-binding proteins [BR:mleu04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    105550009 (KRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase NPR1_interact ATP_bind_1 FeoB_N
Other DBs
NCBI-GeneID: 105550009
NCBI-ProteinID: XP_011850190
LinkDB
Position
Unknown
AA seq 227 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC
VKIKKCIIMGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKCVIM
NT seq 684 nt   +upstreamnt  +downstreamnt
atgactgaatataaacttgtggtagttggagctggtggcgtaggcaagagtgccttgacg
atacagctaattcagaatcattttgtggacgaatatgatccaacaatagaggattcctac
aggaagcaagtagtaattgatggagaaacctgtctcttggatattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt
gtatttgccataaataatactaaatcatttgaagatattcaccattatagagaacaaatt
aaaagagttaaggactctgaagatgtacctatggtcctagtaggaaataaatgtgatttg
ccttctagaacagtagacacaaaacaggctcaggacttagcaagaagttatggaattcct
tttattgaaacatcagcaaagacaagacagagagtggaggatgctttttatacattggtg
agagagatccgacaatacagattgaaaaaaatcagcaaagaagaaaagactcctggctgt
gtgaaaattaaaaaatgcattataatgggtgttgatgatgccttctatacattagttcga
gaaattcgaaaacataaagaaaagatgagcaaagatggtaaaaagaagaaaaagaagtca
aagacaaagtgtgtaattatgtaa

DBGET integrated database retrieval system