Myotis lucifugus (little brown bat): 102424236 Help Entry 102424236         CDS       T07795                                  Symbol RELA Name (RefSeq) transcription factor p65   KO K04735   transcription factor p65 Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf01523   Antifolate resistance mlf04010   MAPK signaling pathway mlf04014   Ras signaling pathway mlf04024   cAMP signaling pathway mlf04062   Chemokine signaling pathway mlf04064   NF-kappa B signaling pathway mlf04066   HIF-1 signaling pathway mlf04071   Sphingolipid signaling pathway mlf04137   Mitophagy - animal mlf04151   PI3K-Akt signaling pathway mlf04210   Apoptosis mlf04211   Longevity regulating pathway mlf04218   Cellular senescence mlf04380   Osteoclast differentiation mlf04613   Neutrophil extracellular trap formation mlf04620   Toll-like receptor signaling pathway mlf04621   NOD-like receptor signaling pathway mlf04622   RIG-I-like receptor signaling pathway mlf04623   Cytosolic DNA-sensing pathway mlf04625   C-type lectin receptor signaling pathway mlf04657   IL-17 signaling pathway mlf04658   Th1 and Th2 cell differentiation mlf04659   Th17 cell differentiation mlf04660   T cell receptor signaling pathway mlf04662   B cell receptor signaling pathway mlf04668   TNF signaling pathway mlf04722   Neurotrophin signaling pathway mlf04917   Prolactin signaling pathway mlf04920   Adipocytokine signaling pathway mlf04926   Relaxin signaling pathway mlf04931   Insulin resistance mlf04932   Non-alcoholic fatty liver disease mlf04933   AGE-RAGE signaling pathway in diabetic complications mlf04936   Alcoholic liver disease mlf05010   Alzheimer disease mlf05022   Pathways of neurodegeneration - multiple diseases mlf05030   Cocaine addiction mlf05132   Salmonella infection mlf05133   Pertussis mlf05134   Legionellosis mlf05135   Yersinia infection mlf05140   Leishmaniasis mlf05142   Chagas disease mlf05145   Toxoplasmosis mlf05146   Amoebiasis mlf05152   Tuberculosis mlf05160   Hepatitis C mlf05161   Hepatitis B mlf05162   Measles mlf05163   Human cytomegalovirus infection mlf05164   Influenza A mlf05165   Human papillomavirus infection mlf05166   Human T-cell leukemia virus 1 infection mlf05167   Kaposi sarcoma-associated herpesvirus infection mlf05168   Herpes simplex virus 1 infection mlf05169   Epstein-Barr virus infection mlf05170   Human immunodeficiency virus 1 infection mlf05171   Coronavirus disease - COVID-19 mlf05200   Pathways in cancer mlf05202   Transcriptional misregulation in cancer mlf05203   Viral carcinogenesis mlf05207   Chemical carcinogenesis - receptor activation mlf05208   Chemical carcinogenesis - reactive oxygen species mlf05212   Pancreatic cancer mlf05215   Prostate cancer mlf05220   Chronic myeloid leukemia mlf05221   Acute myeloid leukemia mlf05222   Small cell lung cancer mlf05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mlf05321   Inflammatory bowel disease mlf05415   Diabetic cardiomyopathy mlf05417   Lipid and atherosclerosis mlf05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mlf00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102424236 (RELA)    04014 Ras signaling pathway     102424236 (RELA)    04064 NF-kappa B signaling pathway     102424236 (RELA)    04668 TNF signaling pathway     102424236 (RELA)    04066 HIF-1 signaling pathway     102424236 (RELA)    04071 Sphingolipid signaling pathway     102424236 (RELA)    04024 cAMP signaling pathway     102424236 (RELA)    04151 PI3K-Akt signaling pathway     102424236 (RELA)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     102424236 (RELA)   09143 Cell growth and death    04210 Apoptosis     102424236 (RELA)    04218 Cellular senescence     102424236 (RELA)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102424236 (RELA)    04620 Toll-like receptor signaling pathway     102424236 (RELA)    04621 NOD-like receptor signaling pathway     102424236 (RELA)    04622 RIG-I-like receptor signaling pathway     102424236 (RELA)    04623 Cytosolic DNA-sensing pathway     102424236 (RELA)    04625 C-type lectin receptor signaling pathway     102424236 (RELA)    04660 T cell receptor signaling pathway     102424236 (RELA)    04658 Th1 and Th2 cell differentiation     102424236 (RELA)    04659 Th17 cell differentiation     102424236 (RELA)    04657 IL-17 signaling pathway     102424236 (RELA)    04662 B cell receptor signaling pathway     102424236 (RELA)    04062 Chemokine signaling pathway     102424236 (RELA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     102424236 (RELA)    04917 Prolactin signaling pathway     102424236 (RELA)    04926 Relaxin signaling pathway     102424236 (RELA)   09156 Nervous system    04722 Neurotrophin signaling pathway     102424236 (RELA)   09158 Development and regeneration    04380 Osteoclast differentiation     102424236 (RELA)   09149 Aging    04211 Longevity regulating pathway     102424236 (RELA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102424236 (RELA)    05202 Transcriptional misregulation in cancer     102424236 (RELA)    05207 Chemical carcinogenesis - receptor activation     102424236 (RELA)    05208 Chemical carcinogenesis - reactive oxygen species     102424236 (RELA)    05203 Viral carcinogenesis     102424236 (RELA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102424236 (RELA)   09162 Cancer: specific types    05212 Pancreatic cancer     102424236 (RELA)    05221 Acute myeloid leukemia     102424236 (RELA)    05220 Chronic myeloid leukemia     102424236 (RELA)    05215 Prostate cancer     102424236 (RELA)    05222 Small cell lung cancer     102424236 (RELA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102424236 (RELA)    05170 Human immunodeficiency virus 1 infection     102424236 (RELA)    05161 Hepatitis B     102424236 (RELA)    05160 Hepatitis C     102424236 (RELA)    05171 Coronavirus disease - COVID-19     102424236 (RELA)    05164 Influenza A     102424236 (RELA)    05162 Measles     102424236 (RELA)    05168 Herpes simplex virus 1 infection     102424236 (RELA)    05163 Human cytomegalovirus infection     102424236 (RELA)    05167 Kaposi sarcoma-associated herpesvirus infection     102424236 (RELA)    05169 Epstein-Barr virus infection     102424236 (RELA)    05165 Human papillomavirus infection     102424236 (RELA)   09171 Infectious disease: bacterial    05132 Salmonella infection     102424236 (RELA)    05135 Yersinia infection     102424236 (RELA)    05133 Pertussis     102424236 (RELA)    05134 Legionellosis     102424236 (RELA)    05152 Tuberculosis     102424236 (RELA)   09174 Infectious disease: parasitic    05146 Amoebiasis     102424236 (RELA)    05145 Toxoplasmosis     102424236 (RELA)    05140 Leishmaniasis     102424236 (RELA)    05142 Chagas disease     102424236 (RELA)   09163 Immune disease    05321 Inflammatory bowel disease     102424236 (RELA)   09164 Neurodegenerative disease    05010 Alzheimer disease     102424236 (RELA)    05022 Pathways of neurodegeneration - multiple diseases     102424236 (RELA)   09165 Substance dependence    05030 Cocaine addiction     102424236 (RELA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102424236 (RELA)    05418 Fluid shear stress and atherosclerosis     102424236 (RELA)    05415 Diabetic cardiomyopathy     102424236 (RELA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     102424236 (RELA)    04932 Non-alcoholic fatty liver disease     102424236 (RELA)    04931 Insulin resistance     102424236 (RELA)    04933 AGE-RAGE signaling pathway in diabetic complications     102424236 (RELA)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     102424236 (RELA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mlf03000]     102424236 (RELA) Transcription factors [BR:mlf03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Rel/Ankyrin     102424236 (RELA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RHD_DNA_bind RHD_dimer Motif Other DBs NCBI-GeneID:  102424236 NCBI-ProteinID:  XP_006101621 Ensembl:  ENSMLUG00000008727 LinkDB All DBs Position Unknown AA seq 545 aa AA seqDB search MDDLFPLIFPSEPAQAPGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT IKIIGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC VKKRDLEQAINQRIQTNNNPFQVPMEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLSPVLS HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE KRKRTYETFKSIMKKSPFNGPTDPRPPPRRIAVPSRSSTSVPKPAPQSYPFTPSLSTINF EEFSPMVFSSGQIPNQPSALAPALVSAMTPALVQAPTPAPVPVLASASSLAQAVAPPAPK PTQAGEGTLTEALLHLQFDADEDLGALLGNNTDPAVFTDLASVDNSEFQQMLNQGVSMAP HTAEPMLMEYPEAITRLVTGSQNPPDPAPAPLGAAGLANGLLAGDEDFSSIADMDFSALL SQISS NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt atggacgacctgttccccctcatcttcccctccgagcccgcccaggcgccgggcccctac gtggagatcatcgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggc cgctcggcgggcagtatccccggcgagaggagcaccgataccaccaagacccaccccacc attaagatcattggctacacggggccggggacggttcgcatctctctggtcaccaaggac cccccacaccggcctcacccccacgagctggtcgggaaagactgccgggatggcttctat gaggctgagctctgcccggaccgctgcatccacagcttccagaacctggggatccaatgt gtgaagaagcgggacctggagcaggccatcaatcagcgcatccagaccaacaacaacccc ttccaagttcccatggaagagcagcgcggagactacgacttgaatgctgtgcggctctgc ttccaggtgacagtgcgggacccatcaggcaggcccctccgcctgtcacctgtcctctct catcccatctttgacaaccgcgcccccaacacagcagagctcaagatctgccgagtgaac cgaaactctgggagctgcctcgggggtgacgagatcttcctgctgtgtgacaaggtgcag aaagaggacatcgaagtgtatttcacgggaccaggctgggaggcccgaggctccttttca caagcggatgtacaccgacaagtggccattgtgttccggacacctccctatgcagacccc agcctgcaggcccccgtgcgcgtctccatgcagctgcggcggccttcagatcgggagctc agcgagcccatggaattccagtacttgccagacacagatgatcgtcaccggattgaggag aagcgcaaaaggacatatgagaccttcaagagcatcatgaagaagagtcctttcaatgga cccaccgacccccggcctcctccccggcgcattgccgtgccttcccgcagctcaacttcc gtccctaagccagctccccagtcctatccctttacgccatccctcagcaccatcaacttt gaggagttttcccccatggtcttttcttctgggcagatcccaaaccaaccctcagccttg gcaccagcccttgtctcagccatgacaccagctctggttcaggccccaaccccagcccct gtcccagtcctagcctcagcctccagccttgctcaggctgtggccccgcctgcccccaag cccacccaggcaggggaaggaacactgacggaggccctgctacatctgcagtttgatgct gatgaagacctgggggccctgctgggcaataatactgacccagccgtgttcacggacctg gcctccgtcgacaactctgagtttcagcagatgctgaaccagggtgtctctatggctccc cacacagcggagcccatgctgatggagtaccctgaggctataacacgcctggtgacaggg tcccagaatccccctgacccagctcctgctcccctgggggccgctggcctcgccaacggc ctcctcgcaggggatgaagacttttcctccatcgcagacatggacttctcagccctactg agtcaaatcagctcctaa

DBGET integrated database retrieval system