Mustela lutreola (European mink): 131815578 Help Entry 131815578         CDS       T09578                                  Symbol RELA Name (RefSeq) transcription factor p65   KO K04735   transcription factor p65 Organism mlk  Mustela lutreola (European mink) Pathway mlk01523   Antifolate resistance mlk04010   MAPK signaling pathway mlk04014   Ras signaling pathway mlk04024   cAMP signaling pathway mlk04062   Chemokine signaling pathway mlk04064   NF-kappa B signaling pathway mlk04066   HIF-1 signaling pathway mlk04071   Sphingolipid signaling pathway mlk04137   Mitophagy - animal mlk04151   PI3K-Akt signaling pathway mlk04210   Apoptosis mlk04211   Longevity regulating pathway mlk04218   Cellular senescence mlk04380   Osteoclast differentiation mlk04613   Neutrophil extracellular trap formation mlk04620   Toll-like receptor signaling pathway mlk04621   NOD-like receptor signaling pathway mlk04622   RIG-I-like receptor signaling pathway mlk04623   Cytosolic DNA-sensing pathway mlk04625   C-type lectin receptor signaling pathway mlk04657   IL-17 signaling pathway mlk04658   Th1 and Th2 cell differentiation mlk04659   Th17 cell differentiation mlk04660   T cell receptor signaling pathway mlk04662   B cell receptor signaling pathway mlk04668   TNF signaling pathway mlk04722   Neurotrophin signaling pathway mlk04917   Prolactin signaling pathway mlk04920   Adipocytokine signaling pathway mlk04926   Relaxin signaling pathway mlk04931   Insulin resistance mlk04932   Non-alcoholic fatty liver disease mlk04933   AGE-RAGE signaling pathway in diabetic complications mlk04936   Alcoholic liver disease mlk05010   Alzheimer disease mlk05022   Pathways of neurodegeneration - multiple diseases mlk05030   Cocaine addiction mlk05132   Salmonella infection mlk05133   Pertussis mlk05134   Legionellosis mlk05135   Yersinia infection mlk05140   Leishmaniasis mlk05142   Chagas disease mlk05145   Toxoplasmosis mlk05146   Amoebiasis mlk05152   Tuberculosis mlk05160   Hepatitis C mlk05161   Hepatitis B mlk05162   Measles mlk05163   Human cytomegalovirus infection mlk05164   Influenza A mlk05165   Human papillomavirus infection mlk05166   Human T-cell leukemia virus 1 infection mlk05167   Kaposi sarcoma-associated herpesvirus infection mlk05168   Herpes simplex virus 1 infection mlk05169   Epstein-Barr virus infection mlk05170   Human immunodeficiency virus 1 infection mlk05171   Coronavirus disease - COVID-19 mlk05200   Pathways in cancer mlk05202   Transcriptional misregulation in cancer mlk05203   Viral carcinogenesis mlk05207   Chemical carcinogenesis - receptor activation mlk05208   Chemical carcinogenesis - reactive oxygen species mlk05212   Pancreatic cancer mlk05215   Prostate cancer mlk05220   Chronic myeloid leukemia mlk05221   Acute myeloid leukemia mlk05222   Small cell lung cancer mlk05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mlk05321   Inflammatory bowel disease mlk05415   Diabetic cardiomyopathy mlk05417   Lipid and atherosclerosis mlk05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mlk00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     131815578 (RELA)    04014 Ras signaling pathway     131815578 (RELA)    04064 NF-kappa B signaling pathway     131815578 (RELA)    04668 TNF signaling pathway     131815578 (RELA)    04066 HIF-1 signaling pathway     131815578 (RELA)    04071 Sphingolipid signaling pathway     131815578 (RELA)    04024 cAMP signaling pathway     131815578 (RELA)    04151 PI3K-Akt signaling pathway     131815578 (RELA)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     131815578 (RELA)   09143 Cell growth and death    04210 Apoptosis     131815578 (RELA)    04218 Cellular senescence     131815578 (RELA)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     131815578 (RELA)    04620 Toll-like receptor signaling pathway     131815578 (RELA)    04621 NOD-like receptor signaling pathway     131815578 (RELA)    04622 RIG-I-like receptor signaling pathway     131815578 (RELA)    04623 Cytosolic DNA-sensing pathway     131815578 (RELA)    04625 C-type lectin receptor signaling pathway     131815578 (RELA)    04660 T cell receptor signaling pathway     131815578 (RELA)    04658 Th1 and Th2 cell differentiation     131815578 (RELA)    04659 Th17 cell differentiation     131815578 (RELA)    04657 IL-17 signaling pathway     131815578 (RELA)    04662 B cell receptor signaling pathway     131815578 (RELA)    04062 Chemokine signaling pathway     131815578 (RELA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     131815578 (RELA)    04917 Prolactin signaling pathway     131815578 (RELA)    04926 Relaxin signaling pathway     131815578 (RELA)   09156 Nervous system    04722 Neurotrophin signaling pathway     131815578 (RELA)   09158 Development and regeneration    04380 Osteoclast differentiation     131815578 (RELA)   09149 Aging    04211 Longevity regulating pathway     131815578 (RELA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     131815578 (RELA)    05202 Transcriptional misregulation in cancer     131815578 (RELA)    05207 Chemical carcinogenesis - receptor activation     131815578 (RELA)    05208 Chemical carcinogenesis - reactive oxygen species     131815578 (RELA)    05203 Viral carcinogenesis     131815578 (RELA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     131815578 (RELA)   09162 Cancer: specific types    05212 Pancreatic cancer     131815578 (RELA)    05221 Acute myeloid leukemia     131815578 (RELA)    05220 Chronic myeloid leukemia     131815578 (RELA)    05215 Prostate cancer     131815578 (RELA)    05222 Small cell lung cancer     131815578 (RELA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     131815578 (RELA)    05170 Human immunodeficiency virus 1 infection     131815578 (RELA)    05161 Hepatitis B     131815578 (RELA)    05160 Hepatitis C     131815578 (RELA)    05171 Coronavirus disease - COVID-19     131815578 (RELA)    05164 Influenza A     131815578 (RELA)    05162 Measles     131815578 (RELA)    05168 Herpes simplex virus 1 infection     131815578 (RELA)    05163 Human cytomegalovirus infection     131815578 (RELA)    05167 Kaposi sarcoma-associated herpesvirus infection     131815578 (RELA)    05169 Epstein-Barr virus infection     131815578 (RELA)    05165 Human papillomavirus infection     131815578 (RELA)   09171 Infectious disease: bacterial    05132 Salmonella infection     131815578 (RELA)    05135 Yersinia infection     131815578 (RELA)    05133 Pertussis     131815578 (RELA)    05134 Legionellosis     131815578 (RELA)    05152 Tuberculosis     131815578 (RELA)   09174 Infectious disease: parasitic    05146 Amoebiasis     131815578 (RELA)    05145 Toxoplasmosis     131815578 (RELA)    05140 Leishmaniasis     131815578 (RELA)    05142 Chagas disease     131815578 (RELA)   09163 Immune disease    05321 Inflammatory bowel disease     131815578 (RELA)   09164 Neurodegenerative disease    05010 Alzheimer disease     131815578 (RELA)    05022 Pathways of neurodegeneration - multiple diseases     131815578 (RELA)   09165 Substance dependence    05030 Cocaine addiction     131815578 (RELA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     131815578 (RELA)    05418 Fluid shear stress and atherosclerosis     131815578 (RELA)    05415 Diabetic cardiomyopathy     131815578 (RELA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     131815578 (RELA)    04932 Non-alcoholic fatty liver disease     131815578 (RELA)    04931 Insulin resistance     131815578 (RELA)    04933 AGE-RAGE signaling pathway in diabetic complications     131815578 (RELA)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     131815578 (RELA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mlk03000]     131815578 (RELA) Transcription factors [BR:mlk03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Rel/Ankyrin     131815578 (RELA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RHD_DNA_bind RHD_dimer Motif Other DBs NCBI-GeneID:  131815578 NCBI-ProteinID:  XP_059003313 LinkDB All DBs Position 1:complement(283566495..283575204) Genome browser AA seq 542 aa AA seqDB search MDDLFPLIFPSEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLSPVLS HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE KRKRTYETFKSIMKKSPFNGPTDPRPPPRRIAVPSRSTTSVPKPAPQPYPFTPSLSTINF EEFSPMVFPSGQIPNQTPALAPAPAPILAPVPAPAPAPAPILAPPGLAQPVAPPAPKTAQ AGEGTLSEALLQLQFDADEDLGALLGSSADPAVFTDLACVDNSEFQQLLNQGVSAAPHTA EPMLMEYPEAITRLVTGSQRPPDPAPAPLGASGLPNGLLSGDEDFSSIADMDFSALLSQI SS NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt atggacgacctgtttcccctcatcttcccgtctgagcctgcgcaggcctctggcccctat gtggagatcatcgagcagcccaagcagcggggaatgcgcttccgctacaagtgcgagggc cgctcagcgggcagtatcccaggcgagaggagcacggataccaccaagacccatcccacc atcaagatcaatggctacacggggccggggacagttcgcatctctctggtcaccaaagac ccccctcaccggcctcacccccatgagcttgtggggaaagactgccgggatggcttctat gaggctgagctctgcccagaccgctgcatccacagcttccagaacctggggatccagtgt gtaaagaagcgggacctggagcaggccatcagtcaacgcatccagaccaataacaatccc ttccaagttcccatagaagaacagcgtggggactatgacctgaacgcagtgcggctctgc ttccaggtgacagtgcgggacccggcaggcaggcccctccgcttgtcacccgtcctctct catcccatttttgacaaccgcgcccccaacactgctgagctcaagatctgccgggtgaac cggaactccgggagctgcctcggcggggatgagatcttcctgctgtgtgacaaggtgcag aaagaggacattgaagtgtatttcacgggaccaggctgggaggcccgaggctccttttca caagctgacgtccaccgacaagtggccattgtgttccggacacctccctacgcggacccc agcctgcaggcccccgtgcgtgtctccatgcagctgcggcggccttcagatcgggagctc agtgagcccatggagttccagtacttgccagacacagatgatcgtcaccggattgaggag aagcgcaaaaggacatacgagaccttcaagagcatcatgaagaaaagtcccttcaatgga cccactgaccccaggcctccgccccggcgcattgcggtgccttcccgaagcacaacttcc gtccccaagccagctccccagccctatccctttacgccatccctcagcaccatcaacttc gaggagttctcccccatggtctttccttcggggcagattccaaaccagacccctgccttg gcaccggcccctgcccccatcctggccccggtcccagccccggccccagccccggcccca atcttagcccccccgggcctcgctcagcctgtggccccccccgcccccaagaccgcccag gccggggaagggacactctcggaggccctgctgcagctgcagtttgacgctgacgaagac ctgggggccctgctgggcagcagcgctgaccccgccgtgttcacagacctggcatgcgtc gacaactcggagtttcagcagctgctgaaccaaggtgtatctgcggccccacacacagcc gagcccatgctgatggagtaccctgaggcaataactcgcctggtgacagggtcccagagg ccccccgacccagctcctgctcccctgggggcctctgggctccccaacggcctcctctca ggggatgaagacttctcctccatcgcagacatggacttctcagccctcctgagtcagatc agctcctaa

DBGET integrated database retrieval system