Mustela lutreola (European mink): 131822740 Help Entry 131822740         CDS       T09578                                  Symbol FGF4 Name (RefSeq) fibroblast growth factor 4   KO K04358   fibroblast growth factor Organism mlk  Mustela lutreola (European mink) Pathway mlk04010   MAPK signaling pathway mlk04014   Ras signaling pathway mlk04015   Rap1 signaling pathway mlk04020   Calcium signaling pathway mlk04151   PI3K-Akt signaling pathway mlk04810   Regulation of actin cytoskeleton mlk05200   Pathways in cancer mlk05207   Chemical carcinogenesis - receptor activation mlk05218   Melanoma mlk05224   Breast cancer mlk05226   Gastric cancer Brite KEGG Orthology (KO) [BR:mlk00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     131822740 (FGF4)    04014 Ras signaling pathway     131822740 (FGF4)    04015 Rap1 signaling pathway     131822740 (FGF4)    04020 Calcium signaling pathway     131822740 (FGF4)    04151 PI3K-Akt signaling pathway     131822740 (FGF4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     131822740 (FGF4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     131822740 (FGF4)    05207 Chemical carcinogenesis - receptor activation     131822740 (FGF4)   09162 Cancer: specific types    05226 Gastric cancer     131822740 (FGF4)    05218 Melanoma     131822740 (FGF4)    05224 Breast cancer     131822740 (FGF4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mlk04052]     131822740 (FGF4)    00536 Glycosaminoglycan binding proteins [BR:mlk00536]     131822740 (FGF4) Cytokines and neuropeptides [BR:mlk04052]  Cytokines   Growth factors (RTK binding)    131822740 (FGF4) Glycosaminoglycan binding proteins [BR:mlk00536]  Heparan sulfate / Heparin   Growth factors/receptors    131822740 (FGF4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  131822740 NCBI-ProteinID:  XP_059015016 LinkDB All DBs Position 1:complement(286525028..286526872) Genome browser AA seq 206 aa AA seqDB search MAGPGAAAAALLPAVLLAVLAPWAGRGGAAAPAAPNGTLGAELERRWESLVARSLARLPV AAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQVLPDGRIGGVHADTSDSLLELSP VERGVVSIFGVASRFFVAMSSKGKLYGSPFFTEECKFKETLLPNNYNAYECYRYPGMFIA LSKTGRTKKGSRVSPTMKVTHFLPRL NT seq 621 nt NT seq  +upstreamnt  +downstreamnt atggcggggcccggggcggccgcggcggcgctgctcccggctgtcctgttggcggtgctg gcgccctgggccggccgagggggcgccgccgcacccgccgcacccaacggcacgctgggg gccgagctggagcgccgctgggagagcctggtggcgcgctcgctggcgcgcctgccggtg gccgcgcagcccaaggaggcggccgtccagagcggcgcgggggactatctcctgggcatc aagcggctgcggcgactctactgcaacgtgggcatcggcttccacctccaggtgctcccc gacggccgcatcggcggcgtgcacgcggacacgagcgacagcctgctggagctgtcgccg gtggagcggggcgtggttagcatctttggcgtggccagccggttcttcgtggccatgagc agcaagggcaagctgtacggctcgccgtttttcacagaggagtgcaagttcaaagagacc ctcctccccaacaactacaacgcctacgagtgctacagataccccggcatgttcatcgcc ttgagcaagaccggcaggaccaagaaagggagccgagtgtcccccaccatgaaggtcacc cactttctccccaggctgtga

DBGET integrated database retrieval system