KEGG   Mesorhizobium japonicum MAFF 303099: mll3997Help
Entry
mll3997           CDS       T00043                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo00473  D-Alanine metabolism
mlo01100  Metabolic pathways
mlo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    mll3997
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    mll3997
Enzymes [BR:mlo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     mll3997
Peptidoglycan biosynthesis and degradation proteins [BR:mlo01011]
 Precursor biosynthesis
  Racemase
   mll3997
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: BAB50762
RhizoBase: mll3997
UniProt: Q98F05
LinkDB All DBs
Position
complement(3195744..3196889)
Genome map
AA seq 381 aa AA seqDB search
MNDAVNPTAAKTVTGWPVSEAAAGAILTIDLGAIRENYRRLKALLGGVHCAGVVKANGYG
LGAAKVAAALTREGCDIFFVALLAEGIALRKAVGTGPDIYVLNGLPPGSEPEAVAAGLCA
VINSGAQLKAWRAAVHDAGRRLPAAIQVDSGMSRLGMAPAEVEALAGDSSAFDGIDIKYV
MSHLACADEPRHPANEQQRLAFERLRAMLPRAPASLANSSGIFLGPSYHHDLARPGAALY
GINPTPGEPNPMLPVVWLQAKVAQTRRIEKGAGIGYGHSYHADGPLSLATISFGYADGWL
RRSASAAWFEGVRLPFLGRVSMDSIILDISALPPGRLREGDLVELLGPSQSVDDAAGHAG
TIGYEILASLGPRFHRHYVGG
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgccgtcaatccgactgctgcgaaaaccgtcaccggttggccggtcagcgag
gccgcggccggcgcgatcctgaccatcgatctcggcgcgatccgtgaaaactaccggcgg
ctgaaggcgctgctgggcggcgtgcactgcgccggcgttgtcaaggccaatggctacggc
cttggcgcggccaaggtggcggcggcactgacccgggaaggctgtgacatcttcttcgtc
gcgctgctggccgaaggcatcgcgctgcgcaaggcggtcgggaccggaccggacatctac
gtgctgaacgggctgccgcctggctccgagccggaagcggtggcggctggcctttgcgcg
gtcatcaatagtggcgcgcagttgaaagcctggcgcgcggcggtgcacgatgccggtcgc
cggctgccggcggccatccaggtcgacagcggcatgtcgcggctcggcatggcgccggcc
gaagtcgaggcgctggccggggatagcagcgcgttcgacggcatcgacatcaaatatgtc
atgagccatctggcctgcgccgacgagccgcgccatccggccaacgaacagcagaggctg
gccttcgaacggctgcgcgccatgctgccccgggcgcccgcctcgctcgccaattcctcc
ggcatctttctcgggccgtcctaccatcacgatctcgctcggcccggagccgcgctctac
ggcatcaacccgacgccgggcgagcccaacccgatgttgcccgtggtgtggctgcaggcc
aaggtggcgcagacgcgccgcatcgaaaagggcgccggcatcggctatggtcacagctat
cacgcggacggtccgctgagcctggcgacgatttcgttcggctatgcggatggctggctg
cgccgctccgcttcggcggcctggttcgaaggcgtgcgcctgcctttcctcgggcgtgtg
tcgatggattcgattattctcgacatctccgctttgccgcccggcaggctgcgcgagggc
gatctggtcgagctgctcggtccctcgcagagcgtcgacgacgccgccggccatgccggc
accatcggctatgaaatcctggccagtctcggcccgcgctttcaccgccactatgtcggc
ggctga

DBGET integrated database retrieval system