KEGG   Muricauda lutaonensis: VC82_2220Help
Entry
VC82_2220         CDS       T03884                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mlt  Muricauda lutaonensis
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mlt00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VC82_2220
  Energy metabolism
   00680 Methane metabolism
    VC82_2220
Enzymes [BR:mlt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     VC82_2220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2355018..2357573
Genome map
AA seq 851 aa AA seqDB search
MSKVKQSERLAEFKKSVTNRFNVYNSLFLNLPYTDMENVGILVPILLDQCEKGLKQGKDP
QEILEAFFTSFAGMPDERARIDFMFRIIQYVERQVVLYDSVEDAAFKKLQEYSESLSIKD
YFELVDQSKNWDKIAKKLASFSARIVLTAHPTQFYTPAVLDIISELQRLIHENRIDDIDM
TLQQLGLTSLVNSQKPTPLEEAKNIIHILRYTYYDAVGSLFKYVRENIKDANFDNYNIIK
LGFWPGGDRDGNPYVTAETTRQVADELRLTLMKCYYNDLKQLRKKLTFKGVQNPLNALNS
NLYKAMFQENFVLGYSEIIEKLSDIRDLLVKDYHSLYLNELDDLIDRVHIFKTHFATLDI
RQDHRKHKAVVEAILKKEGAIKENLGELKENELVDWLLKKDLRLKPSDYSDDIVKDTIAN
IRQLKDIQAKNGEEGCNRYIISNSEDIFSVLFVFGLFRWCGWKTNEITFDIVPLFETMKG
MDASEAVMQALFDIPEYRSHLVRRNNAHTIMLGFSDGTKDGGYLKANWSILNTKETLSKV
CKNNGIKAIFFDGRGGPPARGGGKTHRFYAAQTKDVANHEIQLTIQGQTITSTYGTKEQF
MHNAEQLLTAGLSNNLFGKQHVISAAQRKLIEELSELSYEKYEALKQHDKFIPYLEKRST
LKYYTKANIGSRPGKRGNKEKLTLSDLRAISFVGSWSQLKQNVPGYFGLGTAIYTLKKQG
RFNEVKKLYKEVPFFRALMHNSMMSLAKTNFDLTSYMADDKEFGDFWNILFDEYKLSKKM
LLQVSGHEILMEDEVVSRESVKIREKIVLPLLVIQQNALYHITKNSKFSKLYEKIVTRSL
YGNINASRNSA
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagtaaagcagtcagaacgtttagcggaatttaaaaagtcggttaccaataga
ttcaatgtttataacagtctttttttgaatttaccatataccgatatggaaaatgtgggc
atcttggtgcccattttgctcgaccagtgtgagaaaggcctgaaacagggcaaagacccc
caagagatactggaggctttttttacaagttttgccggcatgcccgacgaacgtgcccgt
attgattttatgttcaggatcatacagtatgttgagcgacaagttgtgctctacgacagt
gtggaagatgccgctttcaagaagttacaggagtattctgaatcactgtccattaaagat
tattttgagttggtagatcagagcaaaaactgggacaagattgccaagaagctggccagc
tttagtgcgcgaatcgttttgaccgcccaccctacccagttttatacgcctgcggtactc
gacattatttcagaattgcagcgtctgatccacgaaaaccgtatcgatgacattgatatg
accttgcaacaattggggctcacctcgttggtcaactcacagaaacctactccgctcgaa
gaggccaagaacatcatacacatattgcgctacacctactatgatgcggtaggctctctt
tttaaatatgtcagggaaaacatcaaagatgccaattttgacaattacaatatcatcaag
ctgggcttttggccgggcggtgaccgagacggcaacccctatgtcacggcagagaccacc
agacaggttgccgatgaacttcggctgacattgatgaaatgctactacaatgatttgaag
cagcttcgtaaaaaactgacctttaaaggagtacaaaatccgttaaacgcgctcaactcc
aacctgtacaaggccatgtttcaagagaattttgtcttgggctattccgagataatagaa
aaactctctgatatacgtgatttactggtaaaagattaccattctctatacctgaacgag
cttgacgacctgatcgaccgtgtacatatcttcaagacgcattttgccacactggacatt
cgccaagaccatcgaaagcacaaagctgtagtcgaggcaattttaaaaaaagaaggtgcc
atcaaagagaaccttggtgagttgaaagaaaatgaattggtcgactggttattgaaaaaa
gacctcagactgaaaccatctgattatagcgatgatatagtcaaagataccatagccaac
atcaggcagttaaaagacattcaggccaaaaacggagaagagggctgcaaccgctatata
atcagtaattcagaagatattttttcagtgctgtttgtttttggattgttccgttggtgt
gggtggaaaaccaatgagattacctttgatatcgtgccgctctttgaaaccatgaaaggc
atggatgcctcagaagcagtgatgcaagccctttttgatatacctgaataccgttcacat
cttgtaagaagaaataacgcgcataccatcatgttgggcttttctgatggcaccaaagac
ggaggttatctaaaggccaactggtctatattgaacacaaaggaaaccctgagcaaggtc
tgtaaaaataacgggatcaaagccatcttttttgatggcaggggcggcccgcctgcccgt
ggtggtggcaagacgcaccgtttctatgccgcacagaccaaagatgtggccaaccacgag
atacagctaaccatacagggtcagaccattaccagtacctacggtaccaaagagcagttt
atgcacaacgccgaacagctgttgacagcgggtctgagcaacaacctttttggcaagcaa
catgtaatttcggcagcccaaagaaaattgatcgaagagctctcagaattgagctacgag
aaatatgaggcactgaagcagcacgataagtttatcccctatttagagaagcgcagtacg
ctgaaatattatacaaaggccaatatcggcagtaggccgggcaaacgcggaaataaagaa
aaattgaccctttcagatttaagggccatatcgtttgtgggctcatggagccagctaaaa
cagaacgtaccgggttattttggcctgggaactgccatatataccctaaaaaaacaaggt
cgctttaatgaagtaaagaaactgtacaaagaagttcccttttttcgggcgctgatgcac
aatagtatgatgtcgttggcaaagaccaatttcgacctgacaagttatatggcagatgac
aaggaattcggagatttctggaatattctttttgacgaatacaaactgtcaaagaaaatg
ttgctgcaggtttctgggcatgagattttgatggaagacgaagtggtctcgcgcgaatct
gtgaaaattcgcgaaaagattgtcttgccactcttggtaattcagcagaatgcattgtac
cacatcaccaaaaactctaagttcagcaagttgtacgagaaaatagtgacacgttcgcta
tatggaaatatcaatgccagtcgtaactcggcctaa

DBGET integrated database retrieval system