KEGG   Mycobacterium marseillense: CKJ54_01525Help
Entry
CKJ54_01525       CDS       T05049                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
mmal  Mycobacterium marseillense
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
308604..309635
Genome map
AA seq 343 aa AA seqDB search
MAAAEELEVDGIAVRLTNPDKVYFPKLGPKGTKRHLVEYYRAVAGGPMLDTLRDRPSHLQ
RFPDGIDGEEIYQKRIPQHHPDYLETCQVTFPSGRTADALKVTHPAAIVWAAQMGTITLH
PWQVRCPDTDHPDELRIDLDPQPGVAFEQARTVAVDVLRPLLDELGLVGYPKTSGGRGIH
VFLRIATDWDFIEVRRAGIALAREVERRAPDAVTTAWWKEERGERIFVDFNQNARDRTMA
SAYSVRRTPIATVSMPLTWDELAGAEPDEYTMATVPELVLRREDPWAAMDDVAQSISPLL
EMAAADEERGLGDMPYPPNYPKMPGEPKRVQPSRDTDRKNGKK
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgcagaggagctcgaagtcgacggcattgcggtccgcctgaccaatccggac
aaggtgtatttccccaagctggggcccaagggcaccaagcgccacctggtcgagtactac
cgcgccgtcgcgggcgggcccatgctcgacacgctgcgcgaccggcccagccacctgcag
cgattcccggacggcatcgacggcgaggagatctaccagaagcggattccccagcaccat
cccgactacctggaaacctgccaggtgacgtttccgtcgggacggaccgccgacgcgctg
aaggtcacccatcccgccgcgatcgtgtgggcggcgcagatgggcacgatcaccctgcac
ccgtggcaggtgcgctgcccggacaccgaccaccccgacgagctgcgcatcgatttggat
ccgcagcccggcgtcgccttcgaacaggcgcgcaccgtcgcggtcgacgtgttgcggccg
ctgctcgacgagctcggtcttgtcggctacccgaagacatccgggggccgcgggatccac
gtcttcctgcggatcgccaccgactgggatttcatcgaagtgcgccgcgcgggcatcgca
ctggcccgcgaagtggagcgccgcgcgcccgacgccgtcaccacggcgtggtggaaggaa
gaacggggcgagcgcatcttcgtcgatttcaaccagaacgcccgggaccgcaccatggca
tcagcctattcggtgcggcgcacgccgatcgcgacggtgtcgatgccgctgacatgggac
gaattggccggcgccgagcccgacgagtacaccatggcgaccgtgcccgaactggtcttg
cgccgggaagacccttgggccgcaatggatgatgtcgctcagtcgatctcaccgctgttg
gagatggccgcggccgacgaagagcgtggcctcggcgacatgccgtatccaccgaactac
ccgaagatgcccggcgaacccaaacgcgttcagcccagccgggatacggatcgcaaaaac
gggaaaaaataa

DBGET integrated database retrieval system