KEGG   Modestobacter marinus: MODMU_0888Help
Entry
MODMU_0888        CDS       T02167                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase, Carbon dioxide fixing enzyme
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mmar  Modestobacter marinus
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mmar00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MODMU_0888 (ppc)
  Energy metabolism
   00680 Methane metabolism
    MODMU_0888 (ppc)
Enzymes [BR:mmar01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MODMU_0888 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
889560..892331
Genome map
AA seq 923 aa AA seqDB search
MSEATVDVADLHAPDDRESENPLREDIRLLGRVLGEVIGEQAGADVLDLVEATRVEAFRI
RRSEVDRGELAERLAGLEPREANHVIRAFSHFSLLANIAEDVHHERRRRHHRREGSPAQP
GSLAASLQLLDAADLDPAVVARELTGALVVPVVTAHPTEVRRKTVSQVQQQISDLLQRRD
TDDPAWSAHLWREVLTLWQTALLRLSRLRLADEIDEALRYYDLSLFQVVPEINAELRQAL
QQRWPDAGLLATPMLRPGSWIGGDRDGNPFVTADAVRRATTSQAGTALRHHLAELVCLAD
ELSMSDRLVTPTEELYALARAASDDSPFRADEPYRQALRGIYRRLAATALWVLGEVPGPA
PDAVLPAYEAPGELLADLETVDRSLRGHGAGALADDRLARLREAVEVFGFHLCGLDMRQN
SSVHEEVLAELLAWAGVCEDYLALDEPARVALLTGELQLRRPLVRPDAELSELARGELDL
LRAAAEQVALLGPDAIPNYVISMCESVSDVLEVGVLLKEVGLLQLDAAGRPTSPLGISPL
FETIEDLQSAGATLAAMLDHPFYRALVAARGDAQEVMLGYSDSNKDGGYLAANWALYRAE
LALVEVARAGGVRLRLFHGRGGTVGRGGGPSYEAIRAQPPGSVAGALRITEQGEVIAAKY
ASPHLARRNLEALVAATLESTLLDIEGLGEDAEETYALFDDLAARARASYGALVHETPGF
VEWFRAATPIRELAELNIGSRPPSRKAGDKITDLRAIPWVFSWSQARIMLPGWYGTGTAL
ESWVGDSPDRLAQLQDLHARWPFFRTVLSNMGMVLAKTDLELAARYASLVPDAELRDRVF
SQITAEHERSVRMLLAITGDDHLLADNPSLARSIRNRFPYLEPLHHLQVEMLRRRRGGDD
DELVRRCIQLSVNGVATALRNSG
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgaagcaaccgtcgacgtcgccgacctccacgcccccgacgaccgggagtccgag
aacccgctccgcgaggacatccggctgctcggccgggtgctgggggaggtgatcggcgag
caggccggcgcggacgtgctggacctggtcgaggccacccgggtggaggccttccggatc
cgccgctccgaggtggaccgcggtgagctggccgagcggctggccgggctggagccgcgc
gaggccaaccacgtcatccgcgcgttcagccacttctcgctgctggccaacatcgccgag
gacgtgcaccacgagcgccgccgccggcaccaccggcgggagggctccccggcgcagccg
ggcagcctggcggcctcgctgcagctgctcgacgccgccgacctcgaccccgccgtcgtc
gcccgggagctcaccggcgcgctggtcgtgccggtcgtcaccgcgcaccccaccgaggtg
cggcgcaagaccgtctcccaggtccagcagcagatcagcgacctgctgcagcggcgcgac
accgacgacccggcctggtcggcccacctgtggcgcgaggtgctcaccctctggcagacg
gcgctgctgcggctgagccggctgcggctggccgacgagatcgacgaggcgctgcgctac
tacgacctgtcgctgttccaggtggtcccggagatcaacgccgagctgcggcaggcgctg
cagcagcgctggccggacgccgggctgctggccacgccgatgctgcggccgggctcgtgg
atcggcggcgaccgcgacggcaacccgttcgtcaccgccgacgcggtgcgccgggccacc
acctcccaggccgggacggcgctgcgccaccacctggccgagctggtctgcctggccgac
gagctgtccatgtccgaccggttggtcaccccgaccgaggagctgtacgcgctggcccgg
gcggcgtcggacgactcgccgttccgcgccgacgagccctaccggcaggcgctgcgcggc
atctaccggcggctggcggccaccgccctgtgggtgctcggcgaggtccccggcccggcg
ccggacgccgtccttcccgcctacgaggcgccgggcgagctgctcgcggacctggagacg
gtcgaccggtcgctgcgcgggcacggtgccggcgcgctggccgacgaccggctggcccgg
ctgcgggaggccgtggaggtcttcggcttccacctgtgcgggctggacatgcggcagaac
tcctcggtgcacgaggaggtgctggccgagctgctggcctgggcgggggtctgcgaggac
tacctggccctcgacgagccggcccgggtcgcgctgctcaccggcgagctgcagctgcgc
cgcccgctggtgcgcccggacgccgagctctccgagctggcccgcggcgagctggacctg
ctgcgcgccgccgccgagcaggtcgcgctgctcgggcccgacgcgatcccgaactacgtg
atcagcatgtgcgagtcggtcagcgacgtgctggaggtgggcgtcctgctcaaggaggtc
gggctgctgcagttggacgccgcggggcggccgaccagcccgctgggcatctccccgctg
ttcgagacgatcgaggacctgcagtcggccggcgcgaccctggccgcgatgctcgaccac
ccgttctaccgggcgctggtggccgcccgcggcgacgcccaggaggtcatgctcggctac
tccgacagcaacaaggacggcggctacctggcggccaactgggcgctgtaccgggccgag
ctggcgctggtcgaggtcgcccgggccgggggcgtgcggctgcggctgttccacggccgg
ggcggcaccgtcggccgcggcggcgggccgagctacgaggcgatccgcgcgcagccgccg
ggctcggtcgccggcgcgctgcggatcaccgagcagggcgaggtgatcgccgccaagtac
gcctcgccgcacctggcccggcgcaacctggaggcgctggtcgccgccacgctggagtcg
acgctgctggacatcgaggggctgggggaggacgccgaggagacctacgcgctcttcgac
gacctggccgcccgcgcccgggcctcctacggcgcgctggtgcacgagacgcccggcttc
gtcgagtggttccgcgcggccaccccgatccgggagctggcggagctcaacatcggcagc
cggccgccgtcccgcaaggccggggacaagatcaccgacctgcgggccatcccgtgggtg
ttcagctggtcgcaggcccggatcatgctgcccggctggtacggcaccgggacggcgctg
gagtcgtgggtcggcgactcgcccgaccggctcgcgcagctgcaggacctgcacgcccgg
tggccgttcttccgcacggtgctgtccaacatgggcatggtgctggccaagaccgacctg
gagctggccgcccgctacgcctcgcttgtgcccgacgccgagctgcgggaccgggtgttc
agccagatcaccgccgagcacgagcggtcggtgcggatgctgctggcgatcaccggcgac
gaccacctgctggccgacaacccgtcgctggcccggtcgatccgcaaccgcttcccctac
ctggagccgctgcaccacctgcaggtggagatgctgcgccgccgccgcggcggggacgac
gacgagctggtccgccgctgcatccagctgtcggtcaacggcgtcgccaccgccctgcgc
aactcaggctga

DBGET integrated database retrieval system