KEGG   Mycobacterium sp. MCS: Mmcs_1145Help
Entry
Mmcs_1145         CDS       T00367                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mmc  Mycobacterium sp. MCS
Pathway
mmc00250  Alanine, aspartate and glutamate metabolism
mmc00410  beta-Alanine metabolism
mmc00430  Taurine and hypotaurine metabolism
mmc00650  Butanoate metabolism
mmc01100  Metabolic pathways
mmc01110  Biosynthesis of secondary metabolites
mmc01120  Microbial metabolism in diverse environments
mmc02024  Quorum sensing
Module
mmc_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mmc00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Mmcs_1145
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mmcs_1145
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mmcs_1145
   00430 Taurine and hypotaurine metabolism
    Mmcs_1145
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Mmcs_1145
Enzymes [BR:mmc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Mmcs_1145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ABG07258
JGI: Mmcs1145
LinkDB All DBs
Position
1243608..1244993
Genome map
AA seq 461 aa AA seqDB search
MSRTHSRVQHVSPAYTGRLAMAPVPSLRLPDEAMEPQAAYRFIHDELMLDGSSRLNLATF
VTTWMDPEAEKLMAETFDKNMIDKDEYPATAAIEQRCVCMVADLFHAEDLRDDDPNSAIG
VSTIGSSEAVMLAGLAMKWRWRQRLGGDAWKGRTPNLVMGSNVQVVWEKFCRYFDVEPRY
LPMEDGRYVITPEQVLEHVDEDTIGVVAILGTTYTGELEPIGEICAALDKLAADGGVDVP
VHVDAASGGFVVPFLHPDLVWDFRLPRVVSINVSGHKYGLTYPGIGFVVWRNAEQLPEEL
VFRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGRGGYAQVMQSLSQTARWLGDELRD
SEHFELITDGSAIPVVSFRLKGDPGYTEFDISQTLRSYGWQVPAYTMPEGAEDVTVLRVV
VREGFSADLARALRDDMVTVLKHLDELKPGGHFDEVQPFAH
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgcacgcacagtcgcgtccagcacgtctcgcccgcctacaccggcaggttggcg
atggcgccggtgccgtcactgcggctgcccgacgaggcgatggaaccccaggcggcctac
cggttcatccacgacgaactcatgctcgacggcagctcgcggctcaacctcgccaccttc
gtcaccacgtggatggaccccgaggccgagaagctgatggccgagacgttcgacaagaac
atgatcgacaaggacgagtacccggcgaccgcggcgatcgagcagcgttgcgtgtgcatg
gtggccgacctgttccacgccgaggatctgcgcgacgacgacccgaacagcgcgatcggg
gtgtcgacgatcgggtcgagcgaggcggtcatgctcgccgggctggcgatgaaatggcgt
tggcgccagcgcctcggcggcgatgcgtggaagggccgcaccccgaatctggtgatgggg
tcgaacgtccaggtggtgtgggagaagttctgccgctacttcgacgtcgaaccgcgctat
ctgccgatggaggacggtcgctacgtcatcactccggagcaggtgctcgagcacgtcgac
gaggacaccatcggagtggtggcgatcctgggcaccacctacaccggtgaactggagccc
atcggggagatctgcgccgcgctcgacaaattggccgcagacgggggtgtcgacgtgccc
gtccacgtcgacgccgccagcggcgggttcgtggtgccgttcctgcatccggatctggtg
tgggacttccggttgccgcgggtggtgtcgatcaacgtcagtggacacaagtacgggctc
acctatcccggcatcgggttcgtggtgtggcgcaacgccgagcagctacccgaggaactg
gtgttccgggtcaactacctcggcggcgacatgccgacgttcacgctgaacttctctcgt
cccggtaaccaggtggtcggccagtattacaacttcctgcggttgggtcgcggcggctac
gcgcaggtcatgcagtcgctgtcgcagaccgcccggtggctgggcgacgaactgcgcgac
agcgagcatttcgagttgatcaccgacggttcggcgatcccggtcgtgagcttccggttg
aagggcgacccgggctacaccgagttcgacatctcgcagacgttgcgctcctacggctgg
caggtgcccgcgtacaccatgcccgagggcgccgaggacgtcacggtgctcagggtcgtg
gtacgcgaggggttttccgccgatctggcccgcgcgctgcgcgacgacatggtcacggtg
ctcaagcatctcgacgagctcaagccgggtggccacttcgatgaggtgcagccgttcgcc
cattag

DBGET integrated database retrieval system