KEGG   Mycobacterium marinum M: MMAR_2247Help
Entry
MMAR_2247         CDS       T00694                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase, Ppc
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mmi  Mycobacterium marinum M
Pathway
mmi00620  Pyruvate metabolism
mmi00680  Methane metabolism
mmi01100  Metabolic pathways
mmi01120  Microbial metabolism in diverse environments
mmi01200  Carbon metabolism
Module
mmi_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MMAR_2247 (ppc)
  Energy metabolism
   00680 Methane metabolism
    MMAR_2247 (ppc)
Enzymes [BR:mmi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MMAR_2247 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: ACC40696
UniProt: B2HP92
LinkDB All DBs
Position
2701830..2704637
Genome map
AA seq 935 aa AA seqDB search
MVEVSDTALEPIGDVHRTRIGREATEPMRADIRLLGAILGDTVREQNGDEVFELVERARV
EAFRVRHSEIDRAEMARMFEGIDIHHAIPIIRAFSHFALLANVAEDIHRERRRSIHVAAG
EPPQDSSLAATYMKLDAAQLDSATIAEALKGALVSPVITAHPTETRRRTIFETQHRITQL
MRLHAEGHTETDDGRGIEVELRRQVLRLWQTALIRLFRLQISDEIEVGLRYYPAALFEVI
PQVNAEVRDALRARWPDADLLSEPILRPGSWIGGDRDGNPNVTAEVVRLATGSAAFTALA
HYLAELTALAQELSMSARLITVTPELATLADACPAGARPDEPYRRALQVVRGRLSATAAE
ILDQQPQHTLELGLPPYATAAELRADLDTIDASLHNHGAGLLADDRLARLREAVRVFGFH
LSGLDMRQNSDVHEQVVGELLAWAGVHPDYTSLAEAERVELLAAELSTRRPLIRDGAQLS
DLARSELGVLAAAAHAVWTFGPAAVPNYIISMCRSVSDMLEAAVLLKEVGLLDASESEPY
CPVGISPLFETIEDLHNGAAILQAMLDLPLYRALVTARGGCQEVMLGYSDSNKDGGYLAA
NWAVYRAELALVETARKTGIRLRLFHGRGGTVGRGGGPSYQAILAQPPGAVSGSLRLTEQ
GEVIAAKYAEPQMARRNLESLLAATLESTLLDVEGLGDTAAPAYAVLDEVAALAQRAYAE
LVHETPGFVEYFKASTPVSEIGALNIGSRPTSRKPTASIADLRAIPWVLAWSQSRVMLPG
WYGTGSAFEQWLAAGPESEADRLQVLHDLYQRWPFFRSVLSNMAQVMAKSDLELAARYSE
LVADETLRRRVFDKIADEHHRTIAMYKRITGQDDLLADNPALARSVFNRFPYLEPLNHLQ
VELLRRYRSGEDDESVQRGILLTMNGLASALRNSG
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
atggttgaggtgtccgataccgcactcgagcccattggcgacgtccaccggacccggatt
ggccgcgaggctaccgaaccaatgcgagccgacatcagactgctgggcgccatcctcggg
gataccgtccgtgagcaaaacggtgacgaggtcttcgagttggtggagcgggcgcgggtg
gaggcctttcgggtgcggcactccgagatcgaccgcgccgagatggcgcgcatgttcgag
ggcatcgacatccaccacgccatcccgatcatccgtgcgttcagtcacttcgcgttgctg
gccaatgtggccgaagacatccaccgggagcgccgtcgaagcattcacgtcgccgccggt
gagccgccgcaggacagcagtctggccgccacgtacatgaaacttgacgcggcccagttg
gattcggcaaccatcgccgaagcgctgaagggcgcactagtgtctccggtcatcaccgcc
catccgaccgagacccggcggcgcaccattttcgagacccagcaccggatcacccagttg
atgcggttgcacgcggaaggacacaccgaaaccgacgacgggcgcggcatcgaagtcgaa
ttgcgtcggcaggtcttgaggttgtggcagaccgcgctgatccggctgtttcggttacag
atctccgacgagatcgaggtcgggttgcggtactacccggcggcgctcttcgaggtgatt
ccgcaggtgaatgccgaggtgcgggatgcgttgcgagcccgctggcccgatgccgacctg
ctttccgaacccattttgcggccgggctcgtggatcggcggggaccgggacggaaacccg
aacgtcaccgccgaggtggttcggctggccaccggcagtgccgctttcaccgcgctggcg
cactacctggccgaactgacggcgctcgcgcaggagctttcgatgtcggcgcgactgatc
accgtcacccccgaattggccacgctggccgatgcctgtccggcgggtgcccgccccgac
gagccgtaccggcgcgccttgcaggtcgtgcgcggccggctcagcgccaccgcggccgaa
atcctggaccagcaaccgcagcacacgctggagttgggcttgccgccatatgccaccgcg
gccgaactgcgggccgatctggacaccatcgatgcctcactgcataaccacggcgccggg
ttgttggccgacgaccggctggcccggctgcgtgaagcggtgcgggtcttcggatttcat
ctctccggcctggacatgcgacagaactccgacgtccacgagcaggtggtcggagagctg
ctcgcgtgggcgggcgtgcacccggactacacctcgctggccgaagcggagcgcgtcgag
ctgttggcggccgaactgagcacccgccggccgctgatccgcgatggcgcgcagctttcc
gatttggctcgcagcgaactgggcgttctggcggccgccgcccacgccgtctggaccttt
ggtcccgccgcggtgcccaactacatcatctcgatgtgccggtcggtatcggacatgctg
gaagccgcggtcctgctcaaagaggtcggcctactggacgcttccgagtcggaaccctat
tgcccggtgggtatctcgccgctgttcgagacgatcgaggacctgcacaacggggcggcc
attctgcaggcgatgttggatcttccgctctatcgcgctttggtgacggcccggggtggt
tgccaggaggtgatgctcggctactcggactcgaacaaggacggcgggtatctggccgcc
aactgggcggtgtatcgagccgaactcgcgctggtggagacggcgcgcaagaccggaatc
cggctgcggctcttccatggccgtggcggcacggtcggccgcggtggcggacccagctac
caggccatcctggcgcagccgccgggtgcggtaagcggatcgttgcggctcaccgaacag
ggtgaagtgatcgccgccaagtacgccgaaccgcagatggcccgacgcaatctggagagc
ctgctggccgccaccctggagtcgacgctgctggacgtcgaggggttgggcgatacggcg
gcgccggcctatgcggtgctcgacgaggtggcggcattggcgcaacgtgcctacgccgaa
ttggtgcacgagacaccgggtttcgtcgagtacttcaaggcttccaccccagtcagcgaa
atcggggcgctgaacatcggcagccggccgacctcgcgcaaacccaccgcttccatcgcc
gacctgcgggccatcccgtgggtgctggcttggagccagtcgcgggtgatgctgcccggc
tggtacggcaccggctcggcattcgagcaatggctggcggcgggtcccgaaagtgaggcc
gaccggctgcaggtgctgcacgacctgtatcagcggtggccgtttttccgcagcgtgctg
tccaacatggcgcaggtgatggccaagagcgacctggaactggcggcccgctactccgaa
ctggtggccgacgaaacgctgcggcgccgggtgttcgacaaaatcgccgacgagcaccac
cgcaccatcgccatgtacaagcgaatcaccggacaagacgacctacttgccgacaacccg
gccctggcgcgctcggtgttcaaccggttcccctacttggaaccgctcaaccaccttcaa
gtcgaactgctccgccgttaccgcagcggtgaggacgacgaatccgtgcagcgcggcatt
ctgctgacgatgaacgggctggccagcgcgctaagaaacagcggctga

DBGET integrated database retrieval system