KEGG   Mycobacterium sp. MOTT36Y: W7S_01570Help
Entry
W7S_01570         CDS       T02113                                 

Definition
(GenBank) hypothetical protein
Organism
mmm  Mycobacterium sp. MOTT36Y
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
325169..326200
Genome map
AA seq 343 aa AA seqDB search
MAAAEEVDVDGVAVRLTNPDKVYFPKLGSRGTKRHLVEYYRAVAGGPMLDTLRDRPSHLQ
RFPDGIDGEEIYQKRIPQHHPDYLETCQVTFPSGRTADALKVTHPAAIVWAAQMGTITLH
PWQVRCPDTDHPDELRIDLDPQPGVAFEQARTVAVDVLRPLLDELGLVGYPKTSGGRGIH
VFLRIATDWDFVEVRRAGIALAREVERRAPDAVTTAWWKEERGERIFVDFNQNARDRTMA
SAYSVRRTPIATVSMPLTWDELAGAEPDDYTMATVPELVARREDPWAAMDDVAQSIASLL
QMAEADEERGLGDMPYPPNYPKMPGEPKRVQPSRDTDRRNGKK
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgcagaagaggtcgacgtcgacggtgtcgcggtccgcctgaccaatcccgac
aaggtgtatttccccaagctgggatcgcggggcaccaagcggcacctggtcgagtactac
cgcgccgtcgccggcggcccgatgctcgacacgctgcgcgaccggcccagccacctgcag
cggttcccggacggcatcgacggcgaggagatctatcagaagcggatcccgcagcaccat
ccggactacttggagacgtgccaggtgacgttcccgtcggggcggaccgccgacgcgctg
aaggtcacccatcccgccgcgatcgtgtgggcggcgcagatgggcacgatcaccctgcac
ccgtggcaggtgcgctgccccgacaccgaccaccccgacgagctgcgcatcgatctggat
ccccagcccggcgtcgccttcgaacaggcgcgtaccgtcgcggtcgacgtgttgcggccg
ctgctcgacgagctcggtctggtcggctacccgaagacatccgggggtcgcgggatccac
gtcttcctgcggatcgccaccgactgggatttcgtcgaggtgcgccgcgcgggcatcgcg
ctggcccgtgaagtggagcgccgtgcgcccgacgccgtcaccaccgcatggtggaaggaa
gaacggggcgagcgcatcttcgtcgacttcaaccagaacgcccgggaccggaccatggcg
tcggcctattcggtgcgacgcacgccgatcgcgacggtgtcgatgccgctgacttgggac
gaattggccggtgccgagccggacgactacaccatggcgaccgtgcccgagctggtcgcg
cgccgggaagacccttgggccgcaatggatgatgttgcccagtcgatcgcgtcgctgctg
caaatggccgaggccgacgaagagcgtggcttgggtgacatgccgtatccgccgaactat
ccgaagatgcccggggagcccaaacgcgttcagcccagccgggatacggatcgcaggaac
gggaagaagtag

DBGET integrated database retrieval system