KEGG   Methanococcus maripaludis C5: MmarC5_0302Help
Entry
MmarC5_0302       CDS       T00491                                 

Definition
(GenBank) Alpha-amylase
  KO
K07405  alpha-amylase [EC:3.2.1.1]
Organism
mmq  Methanococcus maripaludis C5
Pathway
mmq00500  Starch and sucrose metabolism
mmq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmq00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MmarC5_0302
Enzymes [BR:mmq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     MmarC5_0302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57 Polysacc_deac_1 DUF2115
Motif
Other DBs
NCBI-ProteinID: ABO34618
JGI: MmarC50302
UniProt: A4FWP3
LinkDB All DBs
Position
265057..266280
Genome map
AA seq 407 aa AA seqDB search
MLLSLNFEVHQPNRLRKSVNLNSGDLWGRYVDVELNKEIFNKVADKCYIPSNMIMLELID
NYDIEISYSITGVFLEQALEFNEEVVELFRDLAKTGNVEFLGETYHHSLSSLFEEHEEFK
EDILEHKNLIKDLFGYKTTTFRNTELIFNNKIAETIKDMGFNGMFTEGANRILDWRSPNY
VYSSLCGLNVLLRNYNLSDDIGFRFSSRNWKEYPLMADKYAKWVSNTPGDCINLYMDYET
FGEHQWYDTGIFEFLRHLPKELDNHNHIEYATPSEILELCKPKDTIDVFEFSTLSWADSE
RDISAWLGSKMQQLSFQKLKEIRGYLNQYLQQFDEKERKELIEYKIYKNMQTSDNFYYMC
TKGFNDMDVHSYFSHFSTPFDAYAAYLDTYYDFKNHLVLKLLSTYFK
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
gtgttgctgtctcttaattttgaggtccatcaaccaaacaggcttagaaaatctgtaaat
ttaaacagtggggatctttggggccgctatgttgacgtagaattaaacaaagaaattttt
aacaaggtagctgataagtgctatattccatcaaacatgataatgcttgaattaatcgat
aattacgatatcgagatatcttacagtattactggtgtttttttagagcaggctctcgaa
tttaatgaagaagtcgttgaattattcagagatttagcaaaaactggaaatgtagaattt
ttaggtgaaacttaccaccattcattatcgagtctttttgaagaacatgaagaatttaaa
gaagatattcttgaacataaaaacttgataaaagatctttttggatacaaaacaacgact
tttagaaatactgagctgatttttaacaacaaaattgcagaaactattaaagacatggga
tttaacggaatgtttactgaaggcgctaaccgtattttagattggaggtcaccaaattac
gtttatagttctttatgtggattaaatgtacttcttagaaattacaatttaagcgatgat
attggttttagattttcatcaaggaattggaaagaatacccgctaatggctgataaatat
gcaaaatgggtttcaaatactccgggagactgtataaatttatacatggactatgaaacg
tttggagagcaccagtggtatgatacaggaatttttgaatttttaaggcaccttccaaaa
gaactggataaccacaaccacattgaatatgcaacgccttctgaaattcttgaactttgt
aaaccaaaagatactatcgatgtttttgaattttcaactctttcatgggcagattcagaa
agagacattagtgcatggcttggaagtaaaatgcagcagttatcattccagaaattaaaa
gaaataaggggatacctaaaccagtacttacagcaatttgatgaaaaagagcgaaaagag
ttaatagaatataaaatctataagaacatgcagactagtgataatttttactatatgtgc
acgaaaggttttaatgatatggatgtacactcttatttcagccatttttcaacacctttt
gacgcctatgcagcatatctggacacatattatgattttaagaatcatctagttttaaaa
ttactttcaacatattttaaataa

DBGET integrated database retrieval system